The URL can be used to link to this page

Home My WebLink About2023/05/16 Post Agenda Packet REGULAR MEETING OF THE CITY COUNCIL **POSTT AGENDA** Date:Tuesday,May 16,2023,5:00 p.m. Location:Council Chambers,276 Fourth Avenue,Chula Vista,CA Vieww thee Meetingg Livee inn Englishh && Spanish:: chulavistaca.gov/councilmeetings Cox channel 24 in English only Welcomee too yourr Cityy Councill Meeting PUBLICC COMMENTS:: Public comments may be submitted to the City Council in the following ways: In-Person.. The community is welcome to make public comments at this City Council meeting. • Submitt ann eComment: Visit www.chulavistaca.gov/councilmeetings, locate the meeting and click the comment bubble icon. Select the item and click "Leave Comment." eComments can be submitted until the conclusion of public comments for the item and are viewable online upon submittal. If you have difficulty submitting eComments, email comments to: cityclerk@chulavistaca.gov. • HOWW TOO WATCH: Live stream is available at www.chulavistaca.gov/councilmeetings. To switch the video to Spanish, please click on "ES" in the bottom right hand corner. Meetings are available anytime on the City's website (English and Spanish). AC C E S S IB I L IT Y : Individuals with disabilities or special needs are invited to request modifications or accommodations to access and/or participate in a City meeting by contacting the City Clerk’s Office at cityclerk@chulavistaca.gov or (619) 691-5041 (California Relay Service is available for the hearing impaired by dialing 711) at least forty-eight hours in advance of the meeting. SSPEAKER TIME LIMITS: The time allotted for speakers may be adjusted by the Mayor. - Five minutes* for specific items listed on the agenda - Three minutes* for items NOT on the agenda (called to speak during Public Comments) - A group of individuals may select a spokesperson to speak on their behalf on an agenda item, waiving their option to speak individually on the same item. Generally, five minutes are allotted per person, up to a limit of 30 minutes, although the limits may be adjusted. Members of the group must be present. *Individuals who use a translator will be allotted twice the amount of time. GETTING TO KNOW YOUR AGENDA Agenda Sections: CONSENT CALENDAR items are routine items that are not expected to prompt discussion. All items are considered for approval at the same time with one vote. Councilmembers and staff may request items be removed and members of the public may submit a speaker slip if they wish to comment on an item. Items removed from the Consent Calendar are discussed after the vote on the remaining Consent Calendar items. PUBLIC COMMENT provides the public with an opportunity to address the Council on any matter not listed on the agenda that is within the jurisdiction of the Council. In compliance with the Brown Act, the Council cannot take action on matters not listed on the agenda. PPUBLIC HEARINGS are held on matters specifically required by law. The Mayor asks for presentations from staff and from the proponent or applicant involved (if applicable) in the matter under discussion. Following questions from the Councilmembers, the Mayor opens the public hearing and asks for public comments. The hearing is closed, and the City Council may discuss and take action. AACTION ITEMS are items that are expected to cause discussion and/or action by the Council but do not legally require a Public Hearing. Staff may make a presentation and Councilmembers may ask questions of staff and the involved parties before the Mayor invites the public to provide input. CLOSED SESSION may only be attended by members of the Council, support staff, and/or legal counsel. The most common purpose of a Closed Session is to avoid revealing confidential information that may prejudice the legal or negotiating position of the City or compromise the privacy interests of employees. Closed sessions may be held only as specifically authorized by law. Council Actions: RESOLUTIONS are formal expressions of opinion or intention of the Council and are usually effective immediately. ORDINANCES are laws adopted by the Council. Ordinances usually amend, repeal or supplement the Municipal Code; provide zoning specifications; or appropriate money for specific purposes. Most ordinances require two hearings: an introductory hearing, generally followed by a second hearing at the next regular meeting. Most ordinances go into effect 30 days after the final approval. PROCLAMATIONS are issued by the City to honor significant achievements by community members, highlight an event, promote awareness of community issues, and recognize City employees. City of Chula Vista City Council May 16, 2023 Post Agenda Page 2 of 646 Pages 1.CALL TO ORDER 2.ROLL CALL 3.PLEDGE OF ALLEGIANCE TO THE FLAG AND MOMENT OF SILENCE 4.SPECIAL ORDERS OF THE DAY 4.1 Presentation of a Proclamation to Acting Parks Administrator Gilbert Contreras Proclaiming May 20, 2023, as Kids to Parks Day in the City of Chula Vista 4.2 Presentation of a Proclamation Announcing the Opening of Chula Vista Village at Otay and Thanking Funders and Contributors to the City's First Emergency Bridge Shelter 4.3 Presentation of a Proclamation to The Us for Warriors Foundation and Chula Vista Military and Veterans Proclaiming May 2023 as Military Appreciation Month in the City of Chula Vista 4.4 Presentation of a Proclamation to Building Services Supervisor Mel Garcia and Members of the Custodial Group Proclaiming May 21 through 27, 2023, Public Works Week in the City of Chula Vista 5.CONSENT CALENDAR (Items 5.1 through 5.9) All items listed under the Consent Calendar are considered and acted upon by one motion. Anyone may request an item be removed for separate consideration. RECOMMENDED ACTION: Council approve the recommended action on the below consent calendar items. 5.1 Approval of Meeting Minutes 9 RECOMMENDED ACTION: Approve the minutes dated: May 9, 2023 5.2 Waive Reading of Text of Resolutions and Ordinances RECOMMENDED ACTION: Approve a motion to read only the title and waive the reading of the text of all resolutions and ordinances at this meeting. 5.3 Consideration of Request for Excused Absences RECOMMENDED ACTION: Consider requests for excused absences as appropriate. City of Chula Vista City Council May 16, 2023 Post Agenda Page 3 of 646 55.4 Agreement: Approve the Second Amended and Restated Agreement Between the City and SCG - Spicer Consulting Group, LLC. for Special Tax Consultant Services 20 Report Number: 23-0075 Location: No specific geographic location Department: Finance Environmental Notice: This activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3), no environmental review is required. RECOMMENDED ACTION: Adopt a resolution approving the second amended and restated agreement between the City and SCG – Spicer Consulting Group, LLC for special tax consultant services to extend the agreement through September 30, 2023 and increase the compensation amount from $1,000,000 to $1,037,243. 5.5 Open Space Districts: Initiate Proceedings, Approve the Engineer’s Report, Declare the Intention to Levy and Collect Assessments for the Open Space Districts for Fiscal Year 2023-24, and Set a Public Hearing 85 Report Number: 23-0077 Location: No specific geographic location Department: Finance Environmental Notice: The activity is not a "Project" as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. City of Chula Vista City Council May 16, 2023 Post Agenda Page 4 of 646 RRECOMMENDED ACTION: Adopt resolutions A) Initiating proceedings for the levy and collection of assessments for Fiscal Year 2023/24 for Open Space Districts 1 through 11, 14, 15, 17, 18, 20, 23, 24, 26, 31, 33, Eastlake, Town Centre Maintenance District, and Bay Boulevard pursuant to the Landscaping and Lighting Act of 1972; B) Approving the Engineer’s Report, declaring the intention to levy and collect assessments; and setting a public hearing for July 11, 2023, regarding the Fiscal Year 2023/24 assessments for Open Space Districts 2 through 10, 14, 15, 17, 18, 20 (Zones 1 through 6, 8, And 9), 23, 24, 26, 31, 33, Eastlake Maintenance District No 1, Town Centre Maintenance District, and Bay Boulevard Maintenance District; C) Approving the Engineer’s Report, declaring the intention to levy and collect assessments; and setting a public hearing for July 11, 2023, regarding the Fiscal Year 2023/24 assessments for Open Space District 1 and Open Space District 20 Zone 7; and D) Approving the Engineer’s Report, declaring the intention to levy and collect assessments; and setting a public hearing for July 11, 2023, regarding the Fiscal Year 2023/24 assessments for Open Space District 11. 5.6 Agreement: Approve a Sixth Amendment to the Agreement with the Accounting Firm of Lance Soll and Lunghard, LLP to Provide Audit Services 406 Report Number: 23-0105 Location: No specific geographic location Department: Finance Environmental Notice: The activity is not a "Project" as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. RECOMMENDED ACTION: Adopt a resolution approving an amendment to the agreement between City and the accounting firm Lance Soll and Lunghard, LLP for audit services for Fiscal Year 2022-23. 5.7 Agreements: Approve a Form of Agreement with Touchstone Golf, LLC for Management of the Chula Vista Golf Course and Authorize the City Manager to Enter into an Agreement with Huntington National Bank for the Lease of 80 Golf Carts 438 Report Number: 23-0046 Location: Chula Vista Golf Course at 4475 Bonita Road Department: Economic Development Environmental Notice: The activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. City of Chula Vista City Council May 16, 2023 Post Agenda Page 5 of 646 RRECOMMENDED ACTION: Adopt resolutions A) Approving a form of agreement with Touchstone Golf, LLC for professional management services for the Chula Vista Golf Course (form of agreement is attached to the resolution and incorporated in the resolution as Exhibit 1); and B) Authorizing the City Manager to enter into a lease agreement with Huntington National Bank for the lease of 80 golf carts at a cost of $547,296, which will be funded by Touchstone Golf, LLC, as provided for under the agreement between the City and Touchstone Golf, LLC. 5.8 Agreement: Accept Proposals and Award an Agreement with PSC Investigations LLC to Provide Background Investigative Services 478 Report Number: 23-0126 Location: No specific geographic location Department: Police Environmental Notice: The activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. RECOMMENDED ACTION: Adopt a resolution accepting proposals and awarding an agreement to PSC Investigations LLC to provide background investigative services. 5.9 Contracted Janitorial Services: Approve the First Amendment with Nova Commercial to Increase the Maximum Contract Amount and Add Additional Facilities 532 Report Number: 23-0102 Location: City Facilities – including Police, Libraries, and Recreation Centers Department: Public Works Environmental Notice: The activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. RECOMMENDED ACTION: Adopt a resolution approving the first amendment to the agreement with Nova Commercial for janitorial services to increase the maximum not-to-exceed contract amount from $2,250,000 to $3,500,000 over the 5-year term of the agreement and add additional City facilities. 6.PUBLIC COMMENTS 591 The public may address the Council on any matter within the jurisdiction of the Council but not on the agenda. City of Chula Vista City Council May 16, 2023 Post Agenda Page 6 of 646 77.ACTION ITEMS The following item(s) will be considered individually and are expected to elicit discussion and deliberation. 7.1 Harborside Park and American Rescue Plan Act (ARPA): Approve an ARPA Spending Plan Amendment to Provide Park Improvements to Reopen Harborside Park 592 Report Number: 23-0116 Location: 670 Oxford Street Department: Housing and Homeless Services Environmental Notice: The Project qualifies for a Categorical Exemption pursuant to the California Environmental Quality Act State Guidelines Section 15301 Class 1 (Existing Facilities), Section 15303 class 3 (New Construction or Conversion of Small Structures), and Section 15304 Class 4 (Minor Alterations to Land). Under National Environmental Policy Act (NEPA), the activity is exempt pursuant to Title 24, Part 58.34(a)(2)(3) & (10) of the Code of Federal Regulations. RECOMMENDED ACTION: To direct staff to evaluate and provide recommendations to City Council on 1) a joint use agreement with the Chula Vista Elementary School District to provide additional use and oversight of Harborside Park and maintain community access; and 2) options to declare the Harborside Park space surplus land and to require future developments to address community needs, such as including a recreational facility on the site. 8.CITY MANAGER’S REPORTS 9.MAYOR’S REPORTS 9.1 Ratification of Appointments to the Following Commissions:635 - Citizens' Oversight Committee - Measure A Jesse Navarro - Human Relations Commission Christian Gomez 10.COUNCILMEMBERS’ COMMENTS 11.CITY ATTORNEY'S REPORTS 12.CLOSED SESSION Announcements of actions taken in Closed Sessions shall be made available by noon on the next business day following the Council meeting at the City Attorney's office in accordance with the Ralph M. Brown Act (Government Code 54957.7) City of Chula Vista City Council May 16, 2023 Post Agenda Page 7 of 646 112.1 Conference with Labor Negotiators Pursuant to Government Code Section 54957.6 Agency designated representatives: Maria Kachadoorian, Tiffany Allen, Courtney Chase, Tanya Tomlinson, Sarah Schoen, Edward Prendell, and Steven Berliner Employee organization: ACE, IAFF, NIAF, MM/PR, POA, WCE and unrepresented employees. 13.ADJOURNMENT to the regular City Council meeting on May 23, 2023, at 5:00 p.m. in the Council Chambers. Materials provided to the City Council related to an open session item on this agenda are available for public review, please contact the Office of the City Clerk at cityclerk@chulavistaca.gov or (619) 691-5041. Sign up at www.chulavistaca.gov to receive email notifications when City Council agendas are published online. City of Chula Vista City Council May 16, 2023 Post Agenda Page 8 of 646 City of Chula Vista Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Meeting Jointly with the City Council Meeting Minutes May 9, 2023, 5:00 p.m. Council Chambers, 276 Fourth Avenue, Chula Vista, CA Present:Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, Mayor McCann Also Present:City Manager Kachadoorian; Jill Maland representing Lounsbery Ferguson Altona & Peak LLP, Interim Acting City Attorney;City Clerk Bigelow; Assistant City Clerk Turner The City Council minutes are prepared and ordered to correspond to the City Council Agenda. Agenda items may be taken out of order during the meeting. The agenda items were considered in the order presented. _____________________________________________________________________ 1. CALL TO ORDER A regular meeting of the City Council and special meetings of the Successor Agency to the Redevelopment Agency and the Housing Authority of the City of Chula Vista were called to order at 5:00 p.m. in the Council Chambers, located in City Hall, 276 Fourth Avenue, Chula Vista, California. Mayor McCann announced, pursuant to AB 23, that he and each Councilmember would receive $50 for their attendance at that Housing Authority meeting, held simultaneously with the City Council meeting. 2. ROLL CALL City Clerk Bigelow called the roll. Deputy Mayor Preciado arrived at 5:25 p.m. 3. PLEDGE OF ALLEGIANCE TO THE FLAG AND MOMENT OF SILENCE Councilmember Cardenas led the Pledge of Allegiance. 4. SPECIAL ORDERS OF THE DAY 4.1 Introduction by Chula Vista Elementary School District Superintendent Dr. Eduardo Reyes Announcing Speech Contest Winners Giving Their Speech on "What Does This World Need?" Superintendent Dr. Reyes introduced the speech contest winners. x 4th Grade, Dafne Romero Zuniga, Mueller Charter School x 5th Grade, Gerrald Jose, Arroyo Vista Charter School x 6th Grade, Dante Baca, Arroyo Vista Charter School x 8th Grade, Jesus Gonzalez, Discovery Charter School Page 9 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 2 4.2 Presentation of a Proclamation to Chula Vista Police Department Officer Jeff Laine Proclaiming Monday, May 15, 2023, as National Peace Officers Memorial Day in the City of Chula Vista Mayor McCann read the proclamation and Councilmember Cardenas presented it to Officer Laine. 4.3 Presentation by Chula Vista Chamber of Commerce Chief Executive Officer Marcy Weaver on Chula Vista Partnerships, Programs, and Services Chief Executive Officer Weaver gave a presentation on the item. 4.4 Presentation of a Proclamation to the Lupus Foundation of Southern California President Neda Gappy-Cortez Proclaiming May 2023 as Lupus Awareness Month in the City of Chula Vista Mayor McCann read the proclamation and Councilmember Chavez presented it to the Lupus Foundation of Southern California President Gappy-Cortez. 4.5 Presentation of a Proclamation to Reverend Shane Harris Proclaiming May 2023 as National Foster Care Month in the City of Chula Vista Mayor McCann read the proclamation and Councilmember Gonzalez presented it to Reverend Harris. 5. CONSENT CALENDAR (Items 5.1 through 5.4) Item 5.4 was removed from the Consent Calendar at the request of a member of the public. ACTION: Moved by Councilmember Gonzalez Seconded by Councilmember Chavez To approve the recommended actions appearing below consent calendar Items 5.1 through 5.3. The headings were read, text waived. The motion carried by the following vote: Yes (5): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, and Mayor McCann Result: Carried (5 to 0) 5.1 Approval of Meeting Minutes Approve the minutes dated: April 25, 2023 5.2 Waive Reading of Text of Resolutions and Ordinances Approve a motion to read only the title and waive the reading of the text of all resolutions and ordinances at this meeting. 5.3 Consideration of Request for Excused Absences Consider requests for excused absences as appropriate. No requests were received for this meeting. Page 10 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 3 ITEM REMOVED FROM THE CONSENT CALENDAR 5.4 Housing Grant Funding: Approval of the Fiscal Year 2023/24 U.S. Department of Housing and Urban Development Annual Action Plan and Appropriating Funds Mayor McCann stated he would abstain from voting on Item 5.4 due to a potential property-related conflict of interest and he left the dais during the discussion and voting on the item. Alan C, also representing John A., Anna R., Consuelo, Dwayne S., and Paul H, spoke regarding matters related to homelessness. Delia Dominguez Cervantes spoke regarding conflicts of interest. City Manager Kachadoorian and Management Analyst Barnard responded to questions from the City Council. ACTION: Moved by Councilmember Gonzalez Seconded by Councilmember Cardenas To adopt Resolution No. 2023-045, heading read, text waived. The motion carried by the following vote: Yes (4): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, and Deputy Mayor Preciado Conflict (1): Mayor McCann, and Mayor McCann Result: Carried (4 to 0) RESOLUTION NO 2023-045 OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA (1) APPROVING THE FISCAL YEAR 2023/24 U.S. DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT SPENDING PLAN FOR THE COMMUNITY DEVELOPMENT BLOCK GRANT, HOME INVESTMENT PARTNERSHIPS PROGRAM, AND THE EMERGENCY SOLUTIONS GRANT; (2) AUTHORIZING THE CITY MANAGER OR DESIGNEE TO EXECUTE ALL HUD DOCUMENTS RELATED TO THE GRANTS AND AGREEMENTS WITH EACH SUBRECIPIENT; AND, (3) APPROPRIATING FUNDS THEREFOR (4/5 VOTE REQUIRED) Mayor McCann recessed the meeting at 6:02 p.m. The Council reconvened at 6:12 p.m., with all members present. 6. PUBLIC COMMENTS The following members of the public expressed concern about rent increases at Oxford Terrace Apartments: x Valentino Hernandez, Chula Vista resident x Adriana Lara, Chula Vista resident Brandon Claypool, Chula Vista resident, spoke regarding homelessness. John Acosta, Chula Vista resident, spoke regarding councilmembers. Alan C spoke regarding proposed taxes. Marianna Saponara, Chula Vista resident, expressed concern about traffic on Nacion Ave. Page 11 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 4 The following members of the public spoke regarding JEDI community meetings: x Gina Enriquez, Chula Vista resident x Delia Dominguez Cervantes, Chula Vista resident Melinda Jones, representing Mueller Charter School, spoke in support of increased lighting and signage for the crosswalk on J Street. Mayor McCann stated the matter would be referred to staff. Derek Abalos spoke regarding increased rents. The following members of the public spoke regarding labor negotiations and practices. x Jose Puga x Shane Harris Paul Henkin spoke regarding artificial intelligence. Consuelo spoke regarding governments. Aurora, Chula Vista resident, spoke regarding City services. Laura D., Chula Vista resident, spoke regarding JEDI community meetings and human trafficking. Theresa Acerro, Chula Vista resident, submitted written communications regarding JEDI community meetings. 7. BOARD AND COMMISSION REPORTS 7.1 Measure A Citizens’ Oversight Committee Presentation: Annual Report Covering Reporting Period of July 1, 2021 through June 30, 2022 Measure A Citizens' Oversight Committee Chair David Stucky gave a verbal presentation on the item. Delia Dominguez Cervantes, Chula Vista resident, spoke regarding potential conflicts of interest. 8. PUBLIC HEARINGS 8.1 Regional Transportation Improvement Program: Amend the TransNet Local Street Improvement Program of Projects for Fiscal Years 2022/23 through 2026/27 Notice of the hearing was given in accordance with legal requirements, and the hearing was held on the date and no earlier than the time specified in the notice. Senior Civil Engineer Moneda responded to questions from the City Council. Mayor McCann opened the public hearing. John Acosta, Chula Vista resident, spoke in support of staff's recommendation. Alan C. spoke in opposition to staff's recommendation. Delia Dominguez Cervantes, Chula Vista resident, spoke regarding the item. There being no further members of the public who wished to speak, Mayor McCann closed the public hearing. Page 12 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 5 City Clerk Bigelow announced that a revised resolution for Item 8.1 had been distributed to the Council and that action on the item would be with respect to the revised document. Mayor McCann recessed the meeting at 7:24 p.m. The Council reconvened at 7:32 p.m., with all members present, except Councilmember Chavez who arrived at 7:34 p.m. ACTION: Moved by Mayor McCann Seconded by Deputy Mayor Preciado To adopt Resolution No. 2023-046, heading read, text waived. The motion carried by the following vote: Yes (5): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, and Mayor McCann Result: Carried (5 to 0) RESOLUTION NO. 2023-046 OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING AN AMENDMENT TO THE TRANSNET LOCAL STREET IMPROVEMENT PROGRAM OF PROJECTS FOR FISCAL YEARS 2022/23 THROUGH 2026/27 9. ACTION ITEMS 9.1 Mobilehome Rent Control: Reduce the Administrative Fee for Mobilehome Rent Control Services to $10 for Fiscal Year 2023/24 Management Analyst Barnard gave a presentation on the item, he and Housing and Homeless Services Director Kurz responded to questions from the City Council. Paul Henkin submitted written communications in support of staff's recommendation. ACTION: Moved by Deputy Mayor Preciado Seconded by Councilmember Chavez To adopt Resolution No. 2023-047, heading read, text waived. The motion carried by the following vote: Yes (5): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, and Mayor McCann Result: Carried (5 to 0) RESOLUTION NO. 2023-047 OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA AMENDING CHAPTER 18 OF THE CITY’S MASTER FEE SCHEDULE AND SETTING THE ADMINISTRATIVE FEE FOR RENT CONTROL SERVICES AT $10 FOR FISCAL YEAR 2023/24. 9.2 Annual Budget: Hear the Presentation of the City Manager’s Proposed Budget for Fiscal Year 2023-24, Consider Acceptance of the Proposed Budget, and Set a Public Hearing for Final Consideration and Adoption Finance Director Schoen, Budget and Analysis Manager Prendell, and Administrative Services Manager Beamon gave a presentation on the item. City Manager Kachadoorian and Finance Director Schoen responded to questions from the City Council. Council discussion ensued. John Acosta, Chula Vista resident, spoke regarding the item. Page 13 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 6 Paul Henkin submitted written communications expressing a neutral position on the item. ACTION: Moved by Deputy Mayor Preciado Seconded by Councilmember Cardenas To amend the City Manager’s proposed budget to increase the personnel services category for the budgets of the Mayor and City Councilmembers by $5,000 each. The motion carried by the following vote: Yes (5): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, and Mayor McCann Result: Carried (5 to 0) At the request of Councilmember Chavez, there was a consensus of the City Council to make a referral to the City Manager to evaluate and make recommendations regarding matters related to childcare. ACTION: Moved by Deputy Mayor Preciado Seconded by Councilmember Cardenas To adopt Resolution Nos. 2023-048, SA2023-001 and HA 2023-002, as amended by the previous motion to increase the personnel services category for the budgets of the Mayor and City Councilmembers by $5,000 each. The heading below was read, text waived. The motion carried by the following vote: Yes (5): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, and Mayor McCann Result: Carried (5 to 0) RESOLUTION OF THE CITY COUNCIL NO. 2023-048 /SUCCESSOR AGENCY TO THE REDEVELOPMENT AGENCY NO. 2023-001/ HOUSING AUTHORITY NO. 2023-002 OF THE CITY OF CHULA VISTA ACCEPTING THE CITY MANAGER’S PROPOSED OPERATING AND CAPITAL IMPROVEMENT BUDGETS FOR FISCAL YEAR 2023/24 FOR EACH AGENCY AS THEIR PROPOSED BUDGETS, RESPECTIVELY, WITH AMENDMENTS AND SETTING THE TIME AND PLACE FOR A PUBLIC HEARING FOR FINAL CONSIDERATION AND ADOPTION OF SAME 10.CITY MANAGER’S REPORTS There were none. 11.MAYOR’S REPORTS At the request of Mayor McCann, there was a consensus of the City Council to make a referral to the City Manager to evaluate and provide recommendations regarding the installation of two additional pickleball courts at Mackenzie Creek Park. Mayor McCann spoke regarding his attendance at the following recent events: South County Economic Summit, the Taste of Eastlake, the Police Department 31st Annual awards ceremony, and recent Eagle Scout ceremonies. 12.COUNCILMEMBERS’ COMMENTS At the request of Deputy Mayor Preciado, there was a consensus of the City Council to add an item to the May 23, 2023 City Council meeting agenda for a report from the Welcoming America Ad Hoc Subcommittee on findings and recommendations. Page 14 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 7 Councilmember Chavez thanked the community for their participation on the JEDI community meetings and spoke regarding upcoming community forums to address business licenses and permits. She also thanked staff for their hard work on the budget process. Councilmember Gonzalez thanked the community for their participation in the JEDI community meetings and public budget meetings. 12.1 Councilmember Cardenas: Report on findings and recommendations from the Labor Relations Ad-Hoc Subcommittee 1. City-Wide Project Labor Agreement 2. Labor Transparency Ordinance 3. Issues Regarding Livable Wages Councilmember Cardenas gave a report on the item and distributed a memorandum from the subcommittee. John Acosta, Chula Vista resident, spoke regarding transparency. The following members of the public spoke in support of the item: x Matt Blake, representing Local 619 x Victor Diaz, representing Southwest Regional Council of Carpenters x Javier Santizo, and he spoke on behalf of Carlos Sanchez x Sal Espinoza, representing Communications Workers of America, Local 9509 x David Zepeda, representing the International Union of Painters and Allied Trades, Local 1399 x Neill Duggan, representing the International Union of Painters and Allied Trades, Local 1399 x Antonio Sanchez x Matthew Leyba-Gonzalez, representing San Diego Buildings and Construction Trades Council x Carol Kim, representing San Diego Building and Construction Trades Council x Christopher Estrada x Diego Espinosa x Sean Ellis, representing the Plumbers and Pipefitters Union x Kelvin Barrios, representing Laborers International Union, Local 89 The following members of the public submitted written communications in support of the item but were not present when called: x Caesar Zepeda x Oscar Montano x Johnny Reyna Beau Coleman submitted written communications in support of the item but did not wish to speak. Page 15 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 8 The following members of the public submitted written communications in support of the item: x Patrick Davidson x Nephi Hancock The following members of the public submitted written communications in opposition to the item: x Abdur-Rahim Hameed x Dustin Steiner ACTION: Moved by Deputy Mayor Preciado Seconded by Councilmember Cardenas To make a referral to the City Manager for consideration, implementation, and negotiation and a report back to the Council in 90 days on the following recommendations from the subcommittee: 1. Draft a municipal code amendment to address safety conditions and enhancements impacting traffic control workers. 2. Develop a labor transparency ordinance to be consistent with similar policies across the County of San Diego, and identify City needs for ordinance enforcement. 3. Formally engage in the process of developing a citywide Project Labor Agreement (PLA) with input from the San Diego Building and Construction Trades Council. Yes (5): Councilmember Cardenas, Councilmember Chavez, Councilmember Gonzalez, Deputy Mayor Preciado, and Mayor McCann Result: Carried (5 to 0) 13. CITY ATTORNEY'S REPORTS There were none. 14. CLOSED SESSION Pursuant to Resolution No. 13706 and Council Policy No. 346-03, Official Minutes and records of action taken during Closed Sessions are maintained by the City Attorney. Acting City Attorney Maland announced that the Council would convene in closed session to discuss the items listed below. Mayor McCann recessed the meeting at 10:21 p.m. The City Council convened in Closed Session at 10:30 p.m., with all members present. Page 16 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 9 14.1 Conference with Labor Negotiators Pursuant to Government Code Section 54957.6 The following members of the public spoke in support of the item prior to the City Council convening in closed session: x Javier Araiza, representing Local 2180 x David Acosta, representing Local 2180 x David Albright, representing Local 2180 x Nate Fairman, representing IBEW Local Union 465 x Chris Lopez, representing UFCW Local 135 x Brandon Ihde, representing Coronado Firefighters Association x Maribel McKenze, representing UFCW Local 135 x Juan Perez, representing IATSE Local 122 Stagehands Union x Dwayne Garrett, representing Teamsters Local 542 x Kate Bishop x Adan Pelayo x Bernadette Butkiewicz x David Oyos, representing Chula Vista Police Officers Association x Darrell Roberts, representing IAFF Local 2180 x Mike Lopez, representing California Professional Firefighters x Frank Lima, representing International Association of Firefighters x Kelvin Barrios, representing Laborers International Union, Local 89 x Sean Ellis, representing the Plumbers and Pipefitters Union x Carol Kim, representing San Diego Building and Construction Trades Council x Matthew Leyba-Gonzalez, representing San Diego Buildings and Construction Trades Council Beau Coleman submitted written communications in support of the item but did not wish to speak. The following members of the public submitted written communications in support of the item: x Dan Castillo x Brenda Lorena Aguirre x Stephan Gilman x Cesar Fernandez x Chris Canseco x Manny D. x Nadia Kean-Ayub x Chris Colombo x Michael Inzunza x Brandon G. x Lance Buford x Andy W. x Kris Keehl x Matthew C. Gamache x Nathaniel Diaz x Brian Phan Page 17 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 10 x Andrew Dorosan x Ellen Kappes x Royce Copeman x Brian Rice x Tom Lennon x Leticia Munguia The following members of the public submitted written communications in opposition to the item: x John Guzman x R. Diaz x Magdalena x Concerned Citizen x Jon x Franco x Mike x Anthony Gonzalez x John Thompson x Manuel Martinez x A x Jesus Gonzalez x Mike Ramirez x Aloysius Gonzaga x Robert Contreras x Christina Munoz x Gary White x Jorge Jimenez x Yvonne x Mr. Garber Agency designated representatives: Maria Kachadoorian, Tiffany Allen, Courtney Chase, Tanya Tomlinson, Sarah Schoen, Edward Prendell, and Steven Berliner Employee organization: ACE, IAFF, MM/PR, POA, WCE and unrepresented employees. Action: No Reportable Action 14.2 Conference with Legal Counsel Regarding Existing Litigation Pursuant to Government Code Section 54956.9(d)(1) Name of Case: City of Chula Vista, et al. v. Joe Stephenshaw, as Director, et al.; Court of Appeal, Third Appellate District (Sacramento); Case No. C094237 Action: No Reportable Action 14.3 Conference with Legal Counsel Regarding Existing Litigation Pursuant to Government Code Section 54956.9(d)(1) Name of Case: Arturo Castanares v. City of Chula Vista, San Diego Superior Court, Case No. 37-2021-00017713-CU-MC-CTL (Arturo Castanares v. Superior Court of the State of California; Court of Appeal, Fourth Appellate District, Division One; Case No. Pending) Page 18 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2023/05/09 Special Meetings of the Successor Agency to the Redevelopment Agency and Housing Authority Minutes Page 11 Action: No Reportable Action 15. ADJOURNMENT The meeting was adjourned May 10, 2023 at 1:09 a.m. Minutes prepared by: Tyshar Turner, Assistant City Clerk _________________________ Kerry K. Bigelow, MMC, City Clerk Page 19 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda v.003 Page | 1 May 16, 2023 ITEM TITLE Agreement: Approve the Second Amended and Restated Agreement Between the City and SCG - Spicer Consulting Group, LLC. for Special Tax Consultant Services Report Number: 23-0075 Location: No specific geographic location. Department: Finance Environmental Notice: This activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3), no environmental review is required. Recommended Action Adopt a resolution approving the second amended and restated agreement between the City and SCG – Spicer Consulting Group, LLC for special tax consultant services to extend the agreement through September 30, 2023 and increase the compensation amount from $1,000,000 to $1,037,243. SUMMARY The City of Chula Vista desires to amend the current 5-year agreement with Spicer Consulting Group, LLC., to extend the duration from June 30, 2023, to September 30, 2023, to coincide with the end of the tax levy season. ENVIRONMENTAL REVIEW The Development Services Director has reviewed the proposed activity for compliance with the California Environmental Quality Act (CEQA) and has determined that the activity is not a “Project” as defined under Section 15378 of the State CEQA Guidelines because it will not result in a physical change in the environment; therefore, pursuant to Section 15060(c)(3) of the State CEQA Guidelines, the activity is not subject to CEQA. Thus, no environmental review is required. BOARD/COMMISSION/COMMITTEE RECOMMENDATION Not applicable. Page 20 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 2 DISCUSSION The City of Chula Vista entered into a three-year Agreement with Spicer Consulting Group, LLC to perform special tax consultant services for assessment districts, community facilities districts, open space districts, and annual sewer assessment administration services from April 01, 2018 through March 31, 2021 (see Attachment 1). The City then entered into a First Amended Agreement with Spicer Consulting Group, LLC on February 16, 2021 to expand the scope of services to be provided and extend the term of the agreement through June 30, 2022 (see Attachment 2). The parties subsequently signed an Option to Extend, as authorized by the Agreement, to extend the agreement through June 30, 2023 to align with the end of the fiscal year (see Attachment 3). The current agreement with a not-to-exceed limit of $1,000,000 is set to expire June 30, 2023. Spicer’s special tax consultant services include preparing the tax levy, which runs from March through September of every year. Due to a conflict with the levy season schedule, the City wishes to amend the current agreement to extend the duration through September 30, 2023, to align with the end of the levy season, and to add $37,243 to the total maximum compensation amount of $1,000,000 to cover the additional three (3) months, bringing the total maximum compensation amount of this contract to $1,037,243. The proposed Second Amended and Restated agreement, attached as Attachment 4, amends the current agreement accordingly. DECISION-MAKER CONFLICT Staff has reviewed the property holdings of the City Council and has found that Mayor McCann and Councilmember Gonzalez have real property holdings within 500 feet of the boundaries of the property which is the subject of this action, and Councilmember Preciado has real property holdings within 1,00 feet, but beyond 500 feet which is the subject of this action. However, to the extent that any decision would have a reasonably foreseeable financial effect on the member’s real property, the effect would be nominal, inconsequential, or insignificant. Consequently, pursuant to California Code of Regulations Title 2, sections 18700 and 18702 (b), this item does not present a real property-related conflict of interest under the Political Reform Act (Cal. Gov’t Code § 87100, et seq.). Staff is not independently aware and has not been informed by any City Council member, of any other fact that may constitute a basis for a decision-maker conflict of interest in this matter. CURRENT-YEAR FISCAL IMPACT There is no current-year fiscal impact to the General Fund or other funds. The additional three (3) months fall in Fiscal Year 2024. ONGOING FISCAL IMPACT The administrative costs for each non-bonded Special Tax District (Assessment District, Open Space Districts and Maintenance CFDs) will be financed out of the revenue generated by the individual districts via the annual levy. Administrative costs incurred by the bonded districts (Assessment District and Improvement CFDs) will be recovered through the ‘administrative fee’ component of the annual levy, with invoices sent Page 21 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 3 directly to the district’s trustee for payment. These costs include the placement of the annual levy on the tax roll and other administrative tasks as required. The ongoing fiscal impact in Fiscal Year 2024 totals $37,243, which will be included in the budget. Of the $37,243 total cost, $11,303 will be funded by CFD revenues held with the Trustee, $1,159.50 will be funded by revenues collected by Assessment District 97-2, and $24,780.50 will be funded by the maintenance CFDs and Open Space District revenues collected by the City. ATTACHMENTS 1. Original Agreement 2. First Amended and Restated Agreement 3. Notice of Exercise of Option to Extend Agreement 4. Proposed Second Amended and Restated Agreement Staff Contact: Sarah Schoen, Finance Director/Treasurer Page 22 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Form Rev 3/6/2023 RESOLUTION NO. __________ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING SECOND AMENDED AND RESTATED CONSULTANT SERVICES AGREEMENT BETWEEN THE CITY AND SCG – SPICER CONSULTING GROUP, LLC. WHEREAS, the City has formed one Assessment District to provide funding for benefitting properties and infrastructure under the Municipal Improvement Acts of 1913 and 1915; and WHEREAS, the City has also formed 31 Mello-Roos Community Facilities Districts to provide funding for the construction of infrastructure or for the maintenance of open space areas in accordance with the Community Facilities Act of 1982; and WHEREAS, the City has formed 35 Open Space Districts to provide funding for perpetual maintenance of common open space areas; and WHEREAS, the City has one Sewer Assessment District which is a financing mechanism for the collection of wastewater conveyance and treatment service fees for a portion of the City; and WHREAS, the City requires a consultant for the performance of apportionment, delinquency monitoring, administration and other services for the said districts; and WHEREAS, as required by Municipal Code Section 2.56.110, a Request for Proposal (RFP) was prepared and advertised, proposals were received and reviewed, and firms were interviewed and ranked in accordance with selection criteria; and WHEREAS, five firms responded to the RFP, Albert Webb, BLX Group, NBS, Spicer and Willdan Financial Services; and WHEREAS, the selection committee recommended awarding the contract to SCG – Spicer Consulting; and WHEREAS, the parties previously entered into the “Consultant Services Agreement with SCG Special Tax Consultant Services for Assessment Districts, Community Facilities Districts, Open Space Districts, and Annual Sewer Assessment Administration Services” dated April 1, 2018 for the performance of necessary tasks in the administration of the City’s Assessment Districts, Community Facilities Districts, Open Space Districts, and Sewer Assessment District, including delinquency management and apportionment services; and WHEREAS, the parties previously entered into a “First Amended and Restated Consultant Services Agreement with SCG Special Tax Consultant Services for Assessment Districts, Community Facilities Districts, Open Space Districts, and Annual Sewer Assessment Administra tion Services” (“First Amended Agreement”) on February 16, 2021 to add additional services to be performed by Consultant; and Page 23 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Resolution No. Page 2 WHEREAS, the parties previously exercised an Option to Extend the First Amended Agreement on for an additional term defined as a one-year increment from July 1, 2022 to June 30, 2023; and WHEREAS, the City and Consultant have identified the need for an additional 3-month extension of this contract, warranting this Second Amended Agreement; and WHEREAS, a 3-month extension of this contract will result in an increase in the total contract amount from $1,000,000 to $1,037,243; and WHEREAS, Consultant warrants and represents that it is experienced and staffed in a manner such that it can deliver the services required of Consultant to City in accordance with the time frames and the terms and conditions of this Agreement. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it approves the Second Amended and Restated Consultant Services Agreement, between the City and SCG – Spicer Consulting Group, LLC, in the form presented, with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Clerk, and authorizes and directs the Mayor to execute same. Presented by Approved as to form By: Sarah Schoen Jill D.S. Maland Director of Finance/Treasurer Lounsbery Ferguson Altona & Peak Acting City Attorney Page 24 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 1 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 CITY OF CHULA VISTA CONSULTANT SERVICES AGREEMENT WITH SCG - SPICER CONSULTING GROUP, LLC TO PROVIDE SPECIAL TAX CONSULTANT SERVICES FOR ASSESSMENT DISTRICTS, COMMUNITY FACILITIES DISTRICTS, OPEN SPACE DISTRICTS AND ANNUAL SEWER ASSESSMENT ADMINISTRATION SERVICES This Agreement is entered into effective as of April 01, 2018 (“Effective Date”)by and between the City of Chula Vista, a chartered municipal corporation (“City”) and SCG - Spicer consulting group, LLC, a California Limited Liability Company (“Consultant”) (collectively, the “Parties” and, individually, a “Party”) with reference to the following facts: RECITALS WHEREAS,the City has formed one Assessment District to provide funding for benefitting properties and infrastructure under the Municipal Improvement Acts of 1913 and 1915; and WHEREAS,the City has also formed 31 Mello-Roos Community Facilities Districts to provide funding for the construction of infrastructure or for the maintenance of open space areas in accordance withthe Community Facilities Act of 1982; and WHEREAS, the City has formed 35 Open Space Districts to provide funding for perpetual maintenance of common open space areas; and WHEREAS, the City has one Sewer Assessment District which is a financing mechanism for the collection of wastewater conveyance and treatment service fees for a portion of the City. WHREAS, the City requires a consultant for the performance of apportionment, delinquency monitoring, administration and other services for the said districts;and WHEREAS, as required by Municipal Code Section 2.56.110, a Request for Proposal (RFP) was prepared and advertised,proposals were received and reviewed,and firms were interviewed and ranked in accordance with selection criteria;and WHEREAS, five firms responded to the RFP, Albert Webb, BLX Group,NBS, Spicer and Willdan Financial Services;and WHEREAS, the selection committee recommended awarding the contract to SCG -Spicer Consulting Group, LLC;and WHEREAS, the proposed contract will utilize the services of SCG -Spicer Consulting Group, LLC, to perform the necessary tasks in the administration of the City's Assessment Districts, Community Facilities Districts, Open Space Districts, and Sewer Assessment District including delinquency management and apportionment services; and WHEREAS, Consultant warrants and represents that it is experienced and staffed in a manner such that it can deliver the services required of Consultant to City in accordance with the time frames and the terms and conditions of this Agreement. DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 25 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 [End of Recitals. Next Page Starts Obligatory Provisions.] DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 26 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 3 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 OBLIGATORY PROVISIONS NOW, THEREFORE, in consideration of the above recitals, the covenants contained herein, and other good and valuable consideration, the receipt and sufficiency of which the Parties hereby acknowledge, City and Consultant hereby agree as follows: 1. SERVICES 1.1 Required Services. Consultant agrees to perform the services, and deliver to City the “Deliverables” (if any) described in the attached Exhibit A, incorporated into the Agreement by this reference, within the time frames set forth therein, time being of the essence for this Agreement. The services and/or Deliverables described in Exhibit A shall be referred to herein as the “Required Services.” 1.2 Reductions in Scope of Work. City may independently, or upon request from Consultant, from time to time, reduce the Required Services to be performed by the Consultant under this Agreement. Upon doing so, City and Consultant agree to meet and confer in good faith for the purpose of negotiating a corresponding reduction in the compensation associated with the reduction. 1.3 Additional Services. Subject to compliance with the City’s Charter, codes, policies, procedures and ordinances governing procurement and purchasing authority, City may request Consultant provide additional services related to the Required Services (“Additional Services”). If so, City and Consultant agree to meet and confer in good faith for the purpose of negotiating an amendment to Exhibit A, to add the Additional Services. Unless otherwise agreed, compensation for the Additional Services shall be charged and paid consistent with the rates and terms already provided therein. Once added to Exhibit A, “Additional Services” shall also become “Required Services” for purposes of this Agreement. 1.4 Standard of Care. Consultant expressly warrants and agrees that any and all Required Services hereunder shall be performed in accordance with the highest standard of care exercised by members of the profession currently practicing under similar conditions and in similar locations. 1.5 No Waiver of Standard of Care. Where approval by City is required, it is understood to be conceptual approval only and does not relieve the Consultant of responsibility for complying with all laws, codes, industry standards, and liability for damages caused by negligent acts, errors, omissions, noncompliance with industry standards, or the willful misconduct of the Consultant or its subcontractors. 1.6 Security for Performance. In the event that Exhibit A Section 4 indicates the need for Consultant to provide additional security for performance of its duties under this Agreement, Consultant shall provide such additional security prior to commencement of its Required Services in the form and on the terms prescribed on Exhibit A, or as otherwise prescribed by the City Attorney. 1.7 Compliance with Laws. In its performance of the Required Services, Consultant shall comply with any and all applicable federal, state and local laws, including the Chula Vista Municipal Code. 1.8 Business License. Prior to commencement of work, Consultant shall obtain a business license from City. 1.9 Subcontractors. Prior to commencement of any work, Consultant shall submit for City’s information and approval a list of any and all subcontractors to be used by Consultant in the performance of the Required Services. Consultant agrees to take appropriate measures necessary to ensure that all DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 27 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 4 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 subcontractors and personnel utilized by the Consultant to complete its obligations under this Agreement comply with all applicable laws, regulations, ordinances, and policies, whether federal, state, or local. In addition, if any subcontractor is expected to fulfill any responsibilities of the Consultant under this Agreement, Consultant shall ensure that each and every subcontractor carries out the Consultant’s responsibilities as set forth in this Agreement. 1.10 Term. This Agreement shall commence on the earlier to occur of the Effective Date or Consultant’s commencement of the Required Services hereunder, and shall terminate when the Parties have complied with all their obligations hereunder; provided, however, provisions which expressly survive termination shall remain in effect. 2. COMPENSATION 2.1 General. For satisfactory performance of the Required Services, City agrees to compensate Consultant in the amount(s) and on the terms set forth in Exhibit A, Section 4. Standard terms for billing and payment are set forth in this Section 2. 2.2 Detailed Invoicing. Consultant agrees to provide City with a detailed invoice for services performed each month, within thirty (30) days of the end of the month in which the services were performed, unless otherwise specified in Exhibit A. Invoicing shall begin on the first of the month following the Effective Date of the Agreement. All charges must be presented in a line item format with each task separately explained in reasonable detail. Each invoice shall include the current monthly amount being billed, the amount invoiced to date, and the remaining amount available under any approved budget. Consultant must obtain prior written authorization from City for any fees or expenses that exceed the estimated budget. 2.3 Payment to Consultant. Upon receipt of a properly prepared invoice and confirmation that the Required Services detailed in the invoice have been satisfactorily performed, City shall pay Consultant for the invoice amount within thirty (30) days. Payment shall be made in accordance with the terms and conditions set forth in Exhibit A and section 2.4, below. At City’s discretion, invoices not timely submitted may be subject to a penalty of up to five percent (5%) of the amount invoiced. 2.4 Retention Policy. City shall retain ten percent (10%) of the amount due for Required Services detailed on each invoice (the “holdback amount”). Upon City review and determination of Project Completion, the holdback amount will be issued to Consultant. 2.5 Reimbursement of Costs. City may reimburse Consultant’s out-of-pocket costs incurred by Consultant in the performance of the Required Services if negotiated in advance and included in Exhibit A. Unless specifically provided in Exhibit A, Consultant shall be responsible for any and all out-of-pocket costs incurred by Consultant in the performance of the Required Services. 2.6 Exclusions. City shall not be responsible for payment to Consultant for any fees or costs in excess of any agreed upon budget, rate or other maximum amount(s) provided for in Exhibit A. City shall also not be responsible for any cost: (a) incurred prior to the Effective Date; or (b) arising out of or related to the errors, omissions, negligence or acts of willful misconduct of Consultant, its agents, employees, or subcontractors. 2.7 Payment Not Final Approval. Consultant understands and agrees that payment to the Consultant or reimbursement for any Consultant costs related to the performance of Required Services does not constitute a City final decision regarding whether such payment or cost reimbursement is allowable and eligible for DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 28 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 5 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 payment under this Agreement, nor does it constitute a waiver of any violation by Consultant of the terms of this Agreement. If City determines that Consultant is not entitled to receive any amount of compensation already paid, City will notify Consultant in writing and Consultant shall promptly return such amount. 3. INSURANCE 3.1 Required Insurance. Consultant must procure and maintain, during the period of performance of Required Services under this Agreement, and for twelve months after completion of Required Services, the policies of insurance described on the attached Exhibit B, incorporated into the Agreement by this reference (the “Required Insurance”). The Required Insurance shall also comply with all other terms of this Section. 3.2 Deductibles and Self-Insured Retentions. Any deductibles or self-insured retentions relating to the Required Insurance must be disclosed to and approved by City in advance of the commencement of work. 3.3 Standards for Insurers. Required Insurance must be placed with licensed insurers admitted to transact business in the State of California with a current A.M. Best’s rating of A V or better, or, if insurance is placed with a surplus lines insurer, insurer must be listed on the State of California List of Eligible Surplus Lines Insurers (LESLI) with a current A.M. Best’s rating of no less than A X. For Workers’Compensation Insurance, insurance issued by the State Compensation Fund is also acceptable. 3.4 Subcontractors. Consultant must include all sub-consultants/sub-contractors as insureds under its policies and/or furnish separate certificates and endorsements demonstrating separate coverage for those not under its policies. Any separate coverage for sub-consultants must also comply with the terms of this Agreement. 3.5 Additional Insureds. City, its officers, officials, employees, agents, and volunteers must be named as additional insureds with respect to any policy of general liability, automobile, or pollution insurance specified as required in Exhibit B or as may otherwise be specified by City’s Risk Manager.. The general liability additional insured coverage must be provided in the form of an endorsement to the Consultant’s insurance using ISO CG 2010 (11/85) or its equivalent; such endorsement must not exclude Products/Completed Operations coverage. 3.6 General Liability Coverage to be “Primary.” Consultant’s general liability coverage must be primary insurance as it pertains to the City, its officers, officials, employees, agents, and volunteers. Any insurance or self-insurance maintained by the City, its officers, officials, employees, or volunteers is wholly separate from the insurance provided by Consultant and in no way relieves Consultant from its responsibility to provide insurance. 3.7 No Cancellation. No Required Insurance policy may be canceled by either Party during the required insured period under this Agreement, except after thirty days’ prior written notice to the City by certified mail, return receipt requested. Prior to the effective date of any such cancellation Consultant must procure and put into effect equivalent coverage(s). 3.8 Waiver of Subrogation. Consultant’s insurer(s) will provide a Waiver of Subrogation in favor of the City for each Required Insurance policy under this Agreement. In addition, Consultant waives any right it may have or may obtain to subrogation for a claim against City. 3.9 Verification of Coverage. Prior to commencement of any work, Consultant shall furnish City with original certificates of insurance and any amendatory endorsements necessary to demonstrate to City that DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 29 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 Consultant has obtained the Required Insurance in compliance with the terms of this Agreement. The words “will endeavor” and “but failure to mail such notice shall impose no obligation or liability of any kind upon the company, its agents, or representatives” or any similar language must be deleted from all certificates. The required certificates and endorsements should otherwise be on industry standard forms. The City reserves the right to require, at any time, complete, certified copies of all required insurance policies, including endorsements evidencing the coverage required by these specifications. 3.10 Claims Made Policy Requirements. If General Liability, Pollution and/or Asbestos Pollution Liability and/or Errors & Omissions coverage are required and are provided on a claims-made form, the following requirements also apply: a.The “Retro Date” must be shown, and must be before the date of this Agreement or the beginning of the work required by this Agreement. b. Insurance must be maintained, and evidence of insurance must be provided, for at least five (5) years after completion of the work required by this Agreement. c. If coverage is canceled or non-renewed, and not replaced with another claims-made policy form with a “Retro Date” prior to the effective date of this Agreement, the Consultant must purchase “exten ded reporting” coverage for a minimum of five (5) years after completion of the work required by this Agreement. d. A copy of the claims reporting requirements must be submitted to the City for review. 3.11 Not a Limitation of Other Obligations. Insurance provisions under this section shall not be construed to limit the Consultant’s obligations under this Agreement, including Indemnity. 3.12 Additional Coverage. To the extent that insurance coverage provided by Consultant maintains higher limits than the minimums appearing in Exhibit B, City requires and shall be entitled to coverage for higher limits maintained. 4. INDEMNIFICATION 4.1. General. To the maximum extent allowed by law, Consultant shall protect, defend, indemnify and hold harmless City, its elected and appointed officers, agents, employees and volunteers (collectively, “Indemnified Parties”), from and against any and all claims, demands, causes of action, costs, expenses, (including reasonable attorneys’ fees and court costs), liability, loss, damage or injury, in law or equity, to property or persons, including wrongful death, in any manner arising out of or incident to any alleged acts, omissions, negligence, or willful misconduct of Consultant, its officials, officers, employees, agents, and contractors, arising out of or in connection with the performance of the Required Services, the results of such performance, or this Agreement. This indemnity provision does not include any claims, damages, liability, costs and expenses arising from the sole negligence or willful misconduct of the Indemnified Parties. Also covered is liability arising from, connected with, caused by or claimed to be caused by the active or passive negligent acts or omissions of the Indemnified Parties which may be in combination with the active or passive negligent acts or omissions of the Consultant, its employees, agents or officers, or any third party. 4.2. Modified Indemnity Where Agreement Involves Design Professional Services. Notwithstanding the forgoing, if the services provided under this Agreement are design professional services, as defined by DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 30 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 7 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 California Civil Code section 2782.8, as may be amended from time to time, the defense and indemnity obligation under Section 1, above, shall be limited to the extent required by California Civil Code section 2782.8. 4.3 Costs of Defense and Award. Included in Consultant’s obligations under this Section 4 is Consultant’s obligation to defend, at Consultant’s own cost, expense and risk, any and all suits, actions or other legal proceedings that may be brought or instituted against one or more of the Indemnified Parties. Subject to the limitations in this Section 4, Consultant shall pay and satisfy any judgment, award or decree that may be rendered against one or more of the Indemnified Parties for any and all related legal expenses and costs incurred by any of them. 4.4. Consultant’s Obligations Not Limited or Modified. Consultant’s obligations under this Section 4 shall not be limited to insurance proceeds, if any, received by the Indemnified Parties, or by any prior or subsequent declaration by the Consultant. Furthermore, Consultant’s obligations under this Section 4 shall in no way limit, modify or excuse any of Consultant’s other obligations or duties under this Agreement. 4.5. Enforcement Costs. Consultant agrees to pay any and all costs City incurs in enforcing Consultant’s obligations under this Section 4. 4.6 Survival. Consultant’s obligations under this Section 4 shall survive the termination of this Agreement. 5.FINANCIAL INTERESTS OF CONSULTANT. 5.1 Form 700 Filing. The California Political Reform Act and the Chula Vista Conflict of Interest Code require certain government officials and consultants performing work for government agencies to publicly disclose certain of their personal assets and income using a Statement of Economic Interests form (Form 700). In order to assure compliance with these requirements, Consultant shall comply with the disclosure requirements identified in the attached Exhibit C, incorporated into the Agreement by this reference. 5.2 Disclosures; Prohibited Interests. Independent of whether Consultant is required to file a Form 700, Consultant warrants and represents that it has disclosed to City any economic interests held by Consultant, or its employees or subcontractors who will be performing the Required Services, in any real property or project which is the subject of this Agreement. Consultant warrants and represents that it has not employed or retained any company or person, other than a bona fide employee or approved subcontractor working solely for Consultant, to solicit or secure this Agreement. Further, Consultant warrants and represents that it has not paid or agreed to pay any company or person, other than a bona fide employee or approved subcontractor working solely for Consultant, any fee, commission, percentage, brokerage fee, gift or other consideration contingent upon or resulting from the award or making of this Agreement. Consultant further warrants and represents that no officer or employee of City, has any interest, whether contractual, non- contractual, financial or otherwise, in this transaction, the proceeds hereof, or in the business of Consultant or Consultant’s subcontractors. Consultant further agrees to notify City in the event any such interest is discovered whether or not such interest is prohibited by law or this Agreement. For breach or violation of any of these warranties, City shall have the right to rescind this Agreement without liability. 6. REMEDIES 6.1 Termination for Cause. If for any reason whatsoever Consultant shall fail to perform the Required Services under this Agreement, in a proper or timely manner, or if Consultant shall violate any of the other DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 31 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 8 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 covenants, agreements or conditions of this Agreement (each a “Default”), in addition to any and al l other rights and remedies City may have under this Agreement, at law or in equity, City shall have the right to terminate this Agreement by giving five (5) days written notice to Consultant. Such notice shall identify the Default and the Agreement termination date. If Consultant notifies City of its intent to cure such Default prior to City’s specified termination date, and City agrees that the specified Default is capable of being cured, City may grant Consultant up to ten (10) additional days after the designated termination date to effectuate such cure. In the event of a termination under this Section 6.1, Consultant shall immediately provide City any and all ”Work Product” (defined in Section 7 below) prepared by Consultant as part of the Required Services. Such Work Product shall be City’s sole and exclusive property as provided in Section 7 hereof. Consultant may be entitled to compensation for work satisfactorily performed prior to Consultant’s receipt of the Default notice; provided, however, in no event shall such compensation exceed the amount that would have been payable under this Agreement for such work, and any such compensation shall be reduced by any costs incurred or projected to be incurred by City as a result of the Default. 6.2 Termination or Suspension for Convenience of City. City may suspend or terminate this Agreement, or any portion of the Required Services, at any time and for any reason, with or without cause, by giving specific written notice to Consultant of such termination or suspension at least fifteen (15) days prior to the effective date thereof. Upon receipt of such notice, Consultant shall immediately cease all work under the Agreement and promptly deliver all “Work Product” (defined in Section 7 below) to City. Such Work Product shall be City's sole and exclusive property as provided in Section 7 hereof. Consultant shall be entitled to receive just and equitable compensation for this Work Product in an amount equal to the amount due and payable under this Agreement for work satisfactorily performed as of the date of the termination/suspension notice plus any additional remaining Required Services requested or approved by City in advance that would maximize City’s value under the Agreement. 6.3 Waiver of Claims. In the event City terminates the Agreement in accordance with the terms of this Section, Consultant hereby expressly waives any and all claims for damages or compensation as a result of such termination except as expressly provided in this Section 6. 6.4 Administrative Claims Requirements and Procedures. No suit or arbitration shall be brought arising out of this Agreement against City unless a claim has first been presented in writing and filed with City and acted upon by City in accordance with the procedures set forth in Chapter 1.34 of the Chula Vista Municipal Code, as same may be amended, the provisions of which, including such policies and procedures used by City in the implementation of same, are incorporated herein by this reference. Upon request by City, Consultant shall meet and confer in good faith with City for the purpose of resolving any dispute over the terms of this Agreement. 6.5 Governing Law/Venue. This Agreement shall be governed by and construed in accordance with the laws of the State of California. Any action arising under or relating to this Agreement shall be brought only in San Diego County, State of California. 6.6 Service of Process. Consultant agrees that it is subject to personal jurisdiction in California. If Consultant is a foreign corporation, limited liability company, or partnership that is not registered with the California Secretary of State, Consultant irrevocably consents to service of process on Consultant by first class mail directed to the individual and address listed under “For Legal Notice,” in section 1.B. of Exhibit A to this Agreement, and that such service shall be effective five days after mailing. DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 32 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 9 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 7. OWNERSHIP AND USE OF WORK PRODUCT All reports, studies, information, data, statistics, forms, designs, plans, procedures, systems and any other materials or properties produced in whole or in part under this Agreement in connection with the performance of the Required Services (collectively “Work Product”) shall be the sole and exclusive property of City. No such Work Product shall be subject to private use, copyrights or patent rights by Consultant in the United States or in any other country without the express, prior written consent of City. City shall have unrestricted authority to publish, disclose, distribute, and otherwise use, copyright or patent, in whole or in part, any such Work Product, without requiring any permission of Consultant, except as may be limited by the provisions of the Public Records Act or expressly prohibited by other applicable laws. With respect to computer files containing data generated as Work Product, Consultant shall make available to City, upon reasonable written request by City, the necessary functional computer software and hardware for purposes of accessing, compiling, transferring and printing computer files. 8. GENERAL PROVISIONS 8.1 Amendment. This Agreement may be amended, but only in writing signed by both Parties. 8.2 Assignment. City would not have entered into this Agreement but for Consultant’s unique qualifications and traits. Consultant shall not assign any of its rights or responsibilities under this Agreement, nor any part hereof, without City’s p rior written consent, which City may grant, condition or deny in its sole discretion. 8.3 Authority. The person(s) executing this Agreement for Consultant warrants and represents that they have the authority to execute same on behalf of Consultant and to bind Consultant to its obligations hereunder without any further action or direction from Consultant or any board, principle or officer thereof. 8.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed an original, but all of which shall constitute one Agreement after each Party has signed such a counterpart. 8.5 Entire Agreement. This Agreement together with all exhibits attached hereto and other agreements expressly referred to herein, constitutes the entire Agreement between the Parties with respect to the subject matter contained herein. All exhibits referenced herein shall be attached hereto and are incorporated herein by reference. All prior or contemporaneous agreements, understandings, representations, warranties and statements, oral or written, are superseded. 8.6 Record Retention. During the course of the Agreement and for three (3) years following completion of the Required Services, Consultant agrees to maintain, intact and readily accessible, all data, documents, reports, records, contracts, and supporting materials relating to the performance of the Agreement, including accounting for costs and expenses charged to City, including such records in the possession of sub- contractors/sub-consultants. 8.7 Further Assurances. The Parties agree to perform such further acts and to execute and deliver such additional documents and instruments as may be reasonably required in order to carry out the provisions of this Agreement and the intentions of the Parties. 8.8 Independent Contractor. Consultant is and shall at all times remain as to City a wholly independent contractor. Neither City nor any of its officers, employees, agents or volunteers shall have control over the conduct of Consultant or any of Consultant’s officers, employees, or agents (“Consultant Related DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 33 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 10 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 Individuals”), except as set forth in this Agreement. No Consultant Related Individuals shall be deemed employees of City, and none of them shall be entitled to any benefits to which City employees are entitled, including but not limited to, overtime, retirement benefits, worker's compensation benefits, injury leave or other leave benefits. Furthermore, City will not withhold state or federal income tax, social security tax or any other payroll tax with respect to any Consultant Related Individuals; instead, Consultant shall be solely responsible for the payment of same and shall hold the City harmless with respect to same. Consultant shall not at any time or in any manner represent that it or any of its Consultant Related Individuals are employees or agents of City. Consultant shall not incur or have the power to incur any debt, obligation or liability whatsoever against City, or bind City in any manner. 8.9 Notices. All notices, demands or requests provided for or permitted to be given pursuant to this Agreement must be in writing. All notices, demands and requests to be sent to any Party shall be deemed to have been properly given or served if personally served or deposited in the United States mail, addressed to such Party, postage prepaid, registered or certified, with return receipt requested, at the addresses identified in this Agreement at the places of business for each of the designated Parties as indicated in Exhibit A, or otherwise provided in writing. (End of page. Next page is signature page.) DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 34 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 11 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 SIGNATURE PAGE CONSULTANT SERVICES AGREEMENT IN WITNESS WHEREOF, by executing this Agreement where indicated below, City and Consultant agree that they have read and understood all terms and conditions of the Agreement, that they fully agree and consent to bound by same, and that they are freely entering into this Agreement as of the Effective Date. SCG - SPICER CONSULTING GROUP, LLC CITY OF CHULA VISTA BY:________________________________BY: ________________________________ Shane Spicer MARY CASILLAS SALAS Managing Director MAYOR ATTEST1 BY: ________________________________ Kerry K. Bigelow, MMC City Clerk APPROVED AS TO FORM BY: ________________________________ Glen R. Googins City Attorney 1 Attestation signature only required if the Mayor signs the Agreement. If Mayor is not signing agreement, delete entire attestation signature block. DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 35 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 12 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 EXHIBIT A SCOPE OF WORK AND PAYMENT TERMS 1. Contact People for Contract Administration and Legal Notice A. City Contract Administration: Alicia Granados 276 Fourth Avenue Chula Vista, CA 91910 619-409-5916 Agranados@chulavistaca.gov For Legal Notice Copy to: City of Chula Vista City Attorney 276 Fourth Avenue, Chula Vista, CA 91910 619-691-5037 CityAttorney@chulavistaca.gov B. Consultant Contract Administration: SCG - SPICER CONSULTING GROUP, LLC 41619 Margarita Road, Suite 101, Temecula CA 92591 (951) 208-7870 Shane.spicer@spicercg.com For Legal Notice Copy to: SCG –Spicer Consulting Group, LLC Shane Spicer, Managing Director 41619 Margarita Road, Suite 101, Temecula CA 92591 (951) 208-7870 Shane.spicer@spicercg.com 2. Required Services A. General Description: To provide Special Tax Consultant Services for Assessment Districts (ADs), Community Facilities Districts (CFDs), Open Space Districts (OSDs), and Annual Sewer Assessment Administration Services. B. Detailed Description: Scope of Work Assessment District Administration and Apportionment Services x Apportion of tax lien for each parcel within the assessment district according to the method of spread in the Engineer’s Report; DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 36 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 13 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 x Provide assessment installment information for each parcel for submittal in a timely manner to the County of San Diego for placement on the property tax roll. The information shall be submitted on the media, format, and configuration specified by the County; x Research and resubmit entries rejected bythe County on behalf of the City; x Provide staffing and contact information to field inquiries concerning Assessment District administration, assessments, payoff calculation, and other information regarding district proceedings and annual installments for propert y owners, title companies and other interested parties; x Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the district, including a list of all Assessor Parcel Numbers; x Prepare and record the amended assessment diagrams that result from lot splits or subdivision; x Provide support to Citystaff in researching current and historical tax roll information, ownership, payoff calculation, delinquency notices and delinquent status from the County tax system; x Prepare continuing disclosure reports and event notices for City staff review, as required by district disclosure agreements and SEC Rule 15c2-12, and disseminate approved documents to the Electronic Municipal Market Access (EMMA); x Provide support to Citystaff to maintain compliance with the requirements of State of California Revenue and Taxation Code 163; x Perform required bond call spreads in accordance with applicable state laws and coordinate the early redemption of outstanding bonds as needed; x Provide certification related to specific escrow release tests on as needed basis; x Assist City staff in delinquency management by closely monitoring outstanding district delinquencies, and provide periodic reports to the City presenting aging and current statuses of all delinquent installments; x Provide Arbitrage Calculations at least every five years for each bond issue as well as a final computation on the date on which the last maturity of a bond issue is retired; x Provide Asset Management Services including the ability to estimate future capital asset replacement, as required by staff; x Assist City with new Assessment District formations; and x All other special projects as deemed necessary, including but not limited to refunding analysis. Community Facilities District –Bonded •Review the special tax schedules prepared by the City and ensure that all debt service and administrative expenses are recovered through the annual special tax levies; •Calculate the annual special tax levy for each parcel within the CFD following the guidelines established in the Rate and Method of Apportionment of Special Tax; •Prepare comprehensive special tax installment information for each parcel for submittal in a timely manner to the County of San Diego for placement on the property tax roll. This information shall be submitted on the media, format, and configuration specified by the County; •Research and resubmit entries rejected bythe County on behalf of the City; •Provide staffing and contact information to field inquiries concerning CFD administration, annual special taxes, payoff calculation, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; •Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; •Assist City staff with proper disclosure of special tax information for prospective property purchases as required by Sections 53340.2(b) and 53341.5 of the State of California Government Code; DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 37 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 14 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 •Prepare continuing disclosure reports and event notices for City staff review, as required by district disclosure agreements and SEC Rule 15c2-12, and disseminate approved documents to the Electronic Municipal Market Access (EMMA); •Perform tasks associated with CFD administration, including but not limited to bond call coordination, release of lien, delinquency reporting, foreclosure coordination, and annexation; •Assist Citystaff in providing information to bond rating agencies when needed; •Assist in maintaining current and future CFD law and regulation compliance and notify City staff of any pertinent changes in CFD law and regulations; •Provide certification related to specific escrow release tests on as needed basis; •Assist City staff in delinquency management by closely monitoring outstanding district delinquencies, and provide periodic reports to the City presenting aging and current statuses of all delinquent installments; •Provide Arbitrage Calculations at least every five years for each bond issue as well as a final computation on the date on which the last maturity of a bond issue is retired; •Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff; •All other special projects as deemed necessary, including but not limited to new district formation, tax rate projection, and refunding analysis. Community Facilities District –Maintenance (Non-Bonded) •Calculate the annual special tax levy for each parcel within the CFD following the guidelines established in the Rate and Method of Apportionment of Special Tax; •Prepare comprehensive special tax installment information for each parcel for submittal in a timely manner to the County of San Diego for placement on the property tax roll. The information shall be submitted on the media, format, and configuration specified by the County; •Research and resubmit entries rejected bythe County on behalf of the City; •Provide staffing and contact information to field inquiries concerning CFD administration, annual special taxes, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; •Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; •Assist City staff with proper disclosure of assessment information for prospective property purchases as required by Sections 53340.2(b) and 53341.5 of the State of California Government Code; •Provide annexation services to all subject developments, boundary map recordation, annexation proceedings, such as public hearing and owner election, and Preparation of rates and Method of Apportionment for annexations, data collection, etc.; •Administration and assistance with compliance requirements; •Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff; •Assist City with new District formations; and •All other special projects as deemed necessary, including but not limited to revenue projection and cash flow forecast. Open Space Maintenance Districts •Obtain thorough understanding of the City’s OSD establishment, their boundaries, Parcels and particularities; DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 38 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 15 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 •Review all documentation, databases, and budgets prior to preparing levy analysis, in order to ensure total and complete equity of assessments within each district; •Prepare complete documentation for annual assessment, including Engineer’s Reports and maps; •Attend City Council meetings with OSD-related items, as requested by City staff; •Provide comprehensive assessment installment information for each parcel and submit in a timely manner to the County of San Diego for placement on the property tax roll. The information shall be submitted on the media, format and configuration specified by the County; •Research and resubmit entries rejected bythe County on behalf of the City; •Provide staffing and contact information to field inquiries concerning OSD administration, annual assessments, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; •Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; •Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff, and •Complete all reports on OSD required bythe state and federal agencies. Montgomery Sewer District •Obtain thorough understanding of the Montgomery Sewer District, its boundaries, Parcels, and particularities of the district; •Review all documentation, databases, and budgets prior to preparing levy analysis, in order to ensure total and complete equity of assessments the district; •Work with water agencies and download data from them to determine usage; •Update sewer and meter rate tables with rate updates from the prior year; •Match new accounts to APNs (usually around 2 dozen new accounts/per year); •Run initial assessment, and research zero ($0) assessment parcels; •Provide database/workbook to City Finance Staff to perform second levy check; •Provide comprehensive assessment installment information for each parcel and submit in a timely manner to the County of San Diego for placement on the property tax roll. The information shall be submitted on the media, format and configuration specified by the County; •Research and resubmit entries rejected bythe County on behalf of the City; •Provide staffing and contact information to field inquiries concerning the district administration, annual assessments, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; •Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; and •Complete all reports on the district required by the state and federal agencies. 3. Term:In accordance with Section 1.10 of this Agreement, the term of this Agreement shall begin April 01, 2018 and end on March 31, 2021 for completion of all Required Services. 4. Compensation: DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 39 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 A. Form of Compensation ܈ Single Fixed Fee. For performance of all of the Required Services by Consultant as herein required, City shall pay a single fixed fee of $120,000.00, upon completion of all Required Services to City’s satisfaction. OR ܆ Fixed Fee Paid in Increments. For the completion of each Deliverable of the Required Services, as identified in section 2.B., above, City shall pay the fixed fee associated with each Deliverable, in the amounts set forth below: Task No.Deliverable Amount OR ܆ Time and Materials. For performance of the Required Services by Consultant as identified in Section 2.B., above, City shall pay Consultant for the productive hours of time spent by Consultant in the performance of the Required Services, at the rates or amounts as indicated below: Enter Applicable Hourly Rates B. Reimbursement of Costs ܈ None, the compensation includes all costs OR ܆ Invoiced or agreed-upon amounts as follows: Enter or Attach And Reference Any Agreed-Upon Cost Reimbursements Notwithstanding the foregoing, the maximum amount to be paid to the Consultant for services performed through March 31, 2021 shall not exceed $400,000.00. 5. Special Provisions: ܆ Permitted Sub-Consultants: None ܆ Security for Performance: “None” ܈ Notwithstanding the completion date set forth in Section 3 above, City has option to extend this Agreement for two additional terms, defined as a one-year increment or . The City Manager or Director of Finance/Treasurer shall be authorized to exercise the extensions on behalf of the City. If the City exercises an option to extend, each extension shall be on the same terms and conditions contained herein, provided that the amounts specified in Section 4 above may be increased by up to does not increase over the amounts charged for the immediately preceding term by more than the rate of inflation as reflected by the San Diego Consumer Price Index (“CPI”). In no event shall the increase exceed 5% for any renewal term for each extension. The City shall DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 40 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 17 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 give written notice to Consultant of the City’s election to exercise the extension via the Notice of Exercise of Option to Extend document. ܆ Other: Describe Special Provisions (Delete Line If Not Applicable) ܈ None DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 41 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 18 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 EXHIBIT B INSURANCE REQUIREMENTS Consultant shall adhere to all terms and conditions of Section 3 of the Agreement and agrees to provide the following types and minimum amounts of insurance, as indicated by checking the applicable boxes (x). Type of Insurance Minimum Amount Form ܈ General Liability: Including products and completed operations, personal and advertising injury $2,000,000 per occurrence for bodily injury, personal injury (including death), and property damage. If Commercial General Liability insurance with a general aggregate limit is used, either the general aggregate limit must apply separately to this Agreement or the general aggregate limit must be twice the required occurrence limit Additional Insured Endorsement or Blanket AI Endorsement for City* Waiver of Recovery Endorsement Insurance Services Office Form CG 00 01 *Must be primary and must not exclude Products/Completed Operations ܈ Automobile Liability $1,000,000 per accident for bodily injury, including death, and property damage Insurance Services Office Form CA 00 01 Code 1-Any Auto Code 8-Hired Code 9-Non Owned ܈ Workers’ Compensation Employer’s Liability $1,000,000 each accident $1,000,000 disease policy limit $1,000,000 disease each employee Waiver of Recovery Endorsement ܈ Professional Liability (Errors & Omissions) $1,000,000 each occurrence $2,000,000 aggregate Other Negotiated Insurance Terms: NONE DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 42 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 19 City of Chula Vista Agreement No.: 18024 Consultant Name: SCG - Spicer consulting group, LLC Rev. 10/24/17 EXHIBIT C CONSULTANT CONFLICT OF INTEREST DESIGNATION The Political Reform Act2 and the Chula Vista Conflict of Interest Code3 (“Code”) require designated state and local government officials, including some consultants, to make certain public disclosures using a Statement of Economic Interests form (Form 700). Once filed, a Form 700 is a public document, accessible to any member of the public. In addition, consultants designated to file the Form 700 are also required to comply with certain ethics training requirements.4 ܈ A. Consultant IS a corporation or limited liability company and is therefore EXCLUDED5 from disclosure. ܆ B. Consultant NOT a corporation or limited liability company and disclosure designation is as follows: APPLICABLE DESIGNATIONS FOR INDIVIDUAL(S) ASSIGNED TO PROVIDE SERVICES (Category descriptions available at www.chulavistaca.gov/departments/city-clerk/conflict-of-interest-code.) Name Email Address Applicable Designation Shane Spicer Melissa Bellitire Jonathan Short Shane.spicer@spicercg.com Melissa.bellitire@spicercg.com Jonathan.short@spicercg.com ܆ A. Full Disclosure ܆ B. Limited Disclosure (select one or more of the categories under which the consultant shall file): ܆ 1. ܆ 2. ܆ 3. ܆ 4. ܆ 5. ܆ 6. ܆ 7. Justification: ܈ C. Excluded from Disclosure 1.Required Filers Each individual who will be performing services for the City pursuant to the Agreement and who meets the definition of “Consultant,” pursuant to FPPC Regulation 18700.3, must file a Form 700. 2.Required Filing Deadlines Each initial Form 700 required under this Agreement shall be filed with the Office of the City Clerk via the City's online filing system, NetFile, within 30 days of the approval of the Agreement. Additional Form 700 filings will be required annually on April 1 during the term of the Agreement, and within 30 days of the termination of the Agreement. 3. Filing Designation The City Department Director will designate each individual who will be providing services to the City pursuant to the Agreement as full disclosure, limited disclosure, or excluded from disclosure, based on an analysis of the services the Consultant will provide. Notwithstanding this designation or anything in the Agreement, the Consultant is ultimately responsible for complying with FPPC regulations and filing requirements. If you have any questions regarding filing requirements, please do not hesitate to contact the City Clerk at (619)691-5041, or the FPPC at 1- 866-ASK-FPPC, or (866) 275-3772 *2. Pursuant to the duly adopted City of Chula Vista Conflict of Interest Code, this document shall serve as the written determination of the consultant’s requirement to comply with the disclosure requirements set forth in the Code. Completed by: Patricia Garcia 2 Cal. Gov. Code §§81000 et seq.; FPPC Regs. 18700.3 and 18704. 3 Chula Vista Municipal Code §§2.02.010-2.02.040. 4 Cal. Gov. Code §§53234, et seq. 5 CA FPPC Adv. A-15-147 (Chadwick) (2015); Davis v. Fresno Unified School District (2015) 237 Cal.App.4th 261; FPPC Reg. 18700.3 (Consultant defined as an “individual” who participates in making a governmental decision; “individual” does not incl ude corporation or limited liability company). DocuSign Envelope ID: 3122C68F-B3BE-4B93-B150-28F67A7C236A Page 43 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 44 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 45 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 46 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 47 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 48 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 49 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 50 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 51 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 52 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 53 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 54 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 55 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 56 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 57 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 58 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 59 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 60 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 61 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 62 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 63 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 64 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Document No.: 2022-045 Consultant Name: SCG – SPICER CONSULTING GROUP, LLC Rev. 05/21/2021 NOTICE OF EXERCISE OF OPTION TO EXTEND AGREEMENT CONSULTANT AGREEMENT Pursuant to the terms of that certain agreement entitled TO PROVIDE SPECIAL TAX CONSULTANT SERVICES FOR ASSESSMENT DISTRICTS, COMMUNITY FACILITIES DISTRICTS, OPEN SPACE DISTRICTS AND ANNUAL SEWER ASSESSMENT ADMINISTRATION SERVICES (“Agreement”), entered into effective APRIL 01, 2018, between the City of Chula Vista (“City”) and SCG - SPICER CONSULTING GROUP, LLC (“Consultant”), City hereby exercises its option to extend term of the Agreement as follows: OPTION NO. 2 OF 2 OPTION TERM: 07/01/2022 06/30/2023 MAXIMUM COMPENSATION FOR OPTION TERM (AS AUTHORIZED BY ORIGINAL AGREEMENT): $240,000.00 For services performed during this Option Term, City shall compensate Consultant pursuant to the same terms and conditions as provided for in Section 5 of the Agreement. In no event shall the compensation paid to Consultant for this Option Term exceed the “Maximum Compensation for Option Term” amount, as set forth above. All other terms and conditions of the Agreement shall remain in full force and effect. CITY OF CHULA VISTA BY: _______________________________ SARAH SCHOEN DIRECTOR OF FINANCE APPROVED AS TO FORM BY: _______________________________ GLEN R. GOOGINS CITY ATTORNEY ACKNOWLEDGED AND AGREED SCG - SPICER CONSULTING GROUP, LLC BY: _______________________________ SHANE SPICER MANAGING DIRECTOR FOR REFERENCE PURPOSES: Original Agreement No. Resolution No. Bid No. Page 65 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 1 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 SECOND AMENDED AND RESTATED CITY OF CHULA VISTA CONSULTANT SERVICES AGREEMENT WITH SCG - SPICER CONSULTING GROUP, LLC TO PROVIDE SPECIAL TAX CONSULTANT SERVICES FOR ASSESSMENT DISTRICTS, COMMUNITY FACILITIES DISTRICTS, OPEN SPACE DISTRICTS, AND ANNUAL SEWER ASSESSMENT ADMINISTRATION SERVICES This Agreement is entered into effective as of May 16, 2023 (“Effective Date”) by and between the City of Chula Vista, a chartered municipal corporation (“City”) and SCG - Spicer consulting group, LLC, a California Limited Liability Company (“Consultant”) (collectively, the “Parties” and, individually, a “Party”) with reference to the following facts: RECITALS WHEREAS, the City has formed one Assessment District to provide funding for benefitting properties and infrastructure under the Municipal Improvement Acts of 1913 and 1915; and WHEREAS, the City has also formed 31 Mello-Roos Community Facilities Districts to provide funding for the construction of infrastructure or for the maintenance of open space areas in accordance with the Community Facilities Act of 1982; and WHEREAS, the City has formed 35 Open Space Districts to provide funding for perpetual maintenance of common open space areas; and WHEREAS, the City has one Sewer Assessment District which is a financing mechanism for the collection of wastewater conveyance and treatment service fees for a portion of the City. WHREAS, the City requires a consultant for the performance of apportionment, delinquency monitoring, administration and other services for the said districts; and WHEREAS, as required by Municipal Code Section 2.56.110, a Request for Proposal (RFP) was prepared and advertised, proposals were received and reviewed, and firms were interviewed and ranked in accordance with selection criteria; and WHEREAS, five firms responded to the RFP, Albert Webb, BLX Group, NBS, Spicer and Willdan Financial Services; and WHEREAS, the selection committee recommended awarding the contract to SCG –Spicer Consulting Group, LLC; and WHEREAS, the parties previously entered into the “Consultant Services Agreement with SCG Special Tax Consultant Services for Assessment Districts, Community Facilities Districts, Open Space Districts, and Annual Sewer Assessment Administration Services” dated April 1, 2018 for the performance of necessary tasks in the administration of the City’s Assessment Districts, Community Facilities Districts, Open Space Districts, and Sewer Assessment District, including delinquency management and apportionment services; and Page 66 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 WHEREAS, the parties previously entered into a “First Amended and Restated Consultant Services Agreement with SCG Special Tax Consultant Services for Assessment Districts, Community Facilities Districts, Open Space Districts, and Annual Sewer Assessment Administration Services” (“First Amended Agreement”) on February 16, 2021 to add additional services to be performed by Consultant; and WHEREAS, the parties previously exercised an Option to Extend the First Amended Agreement on for an additional term defined as a one-year increment from July 1, 2022 to June 30, 2023; and WHEREAS, the City and Consultant have identified the need for an additional 3-month extension of the services performed by Consultant, warranting this Second Amended Agreement; and WHEREAS, a 3-month extension of this Agreement will result in an increase in the total contract amount from $1,000,000.00 to $1,037,243.00; and WHEREAS, Consultant warrants and represents that it is experienced and staffed in a manner such that it can deliver the services required of Consultant to City in accordance with the time frames and the terms and conditions of this Agreement. [End of Recitals. Next Page Starts Obligatory Provisions.] Page 67 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 3 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 OBLIGATORY PROVISIONS NOW, THEREFORE, in consideration of the above recitals, the covenants contained herein, and other good and valuable consideration, the receipt and sufficiency of which the Parties hereby acknowledge, City and Consultant hereby agree as follows: 1. SERVICES 1.1 Required Services. Consultant agrees to perform the services, and deliver to City the “Deliverables” (if any) described in the attached Exhibit A, incorporated into the Agreement by this reference, within the time frames set forth therein, time being of the essence for this Agreement. The services and/or Deliverables described in Exhibit A shall be referred to herein as the “Required Services.” 1.2 Reductions in Scope of Work. City may independently, or upon request from Consultant, from time to time, reduce the Required Services to be performed by the Consultant under this Agreement. Upon doing so, City and Consultant agree to meet and confer in good faith for the purpose of negotiating a corresponding reduction in the compensation associated with the reduction. 1.3 Additional Services. Subject to compliance with the City’s Charter, codes, policies, procedures and ordinances governing procurement and purchasing authority, City may request Consultant provide additional services related to the Required Services (“Additional Services”). If so, City and Consultant agree to meet and confer in good faith for the purpose of negotiating an amendment to Exhibit A, to add the Additional Services. Unless otherwise agreed, compensation for the Additional Services shall be charged and paid consistent with the rates and terms already provided therein. Once added to Exhibit A,“Additional Services”shall also become “Required Services”for purposes of this Agreement. 1.4 Standard of Care. Consultant expressly warrants and agrees that any and all Required Services hereunder shall be performed in accordance with the highest standard of care exercised by members of the profession currently practicing under similar conditions and in similar locations. 1.5 No Waiver of Standard of Care. Where approval by City is required, it is understood to be conceptual approval only and does not relieve the Consultant of responsibility for complying with all laws, codes, industry standards, and liability for damages caused by negligent acts, errors, omissions, noncompliance with industry standards, or the willful misconduct of the Consultant or its subcontractors. 1.6 Security for Performance. In the event that Exhibit A Section 4 indicates the need for Consultant to provide additional security for performance of its duties under this Agreement, Consultant shall provide such additional security prior to commencement of its Required Services in the form and on the terms prescribed on Exhibit A, or as otherwise prescribed by the City Attorney. 1.7 Compliance with Laws. In its performance of the Required Services, Consultant shall comply with any and all applicable federal, state and local laws, including the Chula Vista Municipal Code. 1.8 Business License. Prior to commencement of work, Consultant shall obtain a business license from City. 1.9 Subcontractors. Prior to commencement of any work, Consultant shall submit for City’s information and approval a list of any and all subcontractors to be used by Consultant in the performance of the Required Services. Consultant agrees to take appropriate measures necessary to ensure that all Page 68 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 4 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 subcontractors and personnel utilized by the Consultant to complete its obligations under this Agreement comply with all applicable laws, regulations, ordinances, and policies, whether federal, state, or local. In addition, ifany subcontractor is expectedto fulfill anyresponsibilities ofthe Consultant underthis Agreement, Consultant shall ensure that each and every subcontractor carries out the Consultant’s responsibilities as set forth in this Agreement. 1.10 Term. This Agreement shall commence on the earlier to occur of the Effective Date or Consultant’s commencement of the Required Services hereunder, and shall terminate when the Parties have complied with all their obligations hereunder; provided, however, provisions which expressly survive termination shall remain in effect. 2. COMPENSATION 2.1 General. For satisfactory performance of the Required Services, City agrees to compensate Consultant in the amount(s) and on the terms set forth in Exhibit A, Section 4. Standard terms for billing and payment are set forth in this Section 2. 2.2 Detailed Invoicing. Consultant agrees to provide City with a detailed invoice for services performed each month, within thirty (30) days of the end of the month in which the services were performed, unless otherwise specified in Exhibit A. Invoicing shall begin on the first of the month following the Effective Date of the Agreement. All charges must be presented in a line item format with each task separately explained in reasonable detail. Each invoice shall include the current monthly amount being billed, the amount invoiced to date, and the remaining amount available under any approved budget. Consultant must obtain prior written authorization from Cityfor any fees or expenses that exceed the estimated budget. 2.3 Payment to Consultant. Upon receipt of a properly prepared invoice and confirmation that the Required Services detailed in the invoice have been satisfactorily performed, City shall pay Consultant for the invoice amount within thirty (30)days. Payment shall bemadein accordance with theterms and conditions set forth in Exhibit A and section 2.4, below. At City’s discretion, invoices not timely submitted may be subject to a penalty of up to five percent (5%) of the amount invoiced. 2.4 Retention Policy. City shall retain ten percent (10%) of the amount due for Required Services detailed on each invoice (the “holdback amount”). Upon City review and determination of Project Completion, the holdback amount will be issued to Consultant. 2.5 Reimbursement of Costs. City may reimburse Consultant’s out-of-pocket costs incurred by Consultant in the performance of the Required Services if negotiated in advance and included in Exhibit A. Unless specifically provided in Exhibit A, Consultant shall be responsible for any and all out-of-pocket costs incurred by Consultant in the performance of the Required Services. 2.6 Exclusions. City shall not be responsible for payment to Consultant for any fees or costs in excess of any agreed upon budget, rate or other maximum amount(s) provided for in Exhibit A. City shall also not be responsible for any cost: (a) incurred prior to the Effective Date; or (b) arising out of or related to the errors, omissions, negligence or acts of willful misconduct of Consultant, its agents, employees, or subcontractors. 2.7 Payment Not Final Approval. Consultant understands and agrees that payment to the Consultant or reimbursement for any Consultant costs related to the performance of Required Services does not constitute a City final decision regarding whether such payment or cost reimbursement is allowable and eligible for Page 69 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 5 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 payment under this Agreement, nor does it constitute a waiver of any violation by Consultant of the terms of this Agreement. If City determines that Consultant is not entitled to receive any amount of compensation already paid, City will notify Consultant in writing and Consultant shall promptly return such amount. 3. INSURANCE 3.1 Required Insurance. Consultant must procure and maintain, during the period of performance of Required Services under this Agreement, and for twelve months after completion of Required Services, the policies of insurance described on the attached Exhibit B, incorporated into the Agreement by this reference (the “Required Insurance”). The Required Insurance shall also complywith all other terms of this Section. 3.2 Deductibles and Self-Insured Retentions. Any deductibles or self-insured retentions relating to the Required Insurance must be disclosed to and approved by City in advance of the commencement of work. 3.3 Standards for Insurers. Required Insurance must be placed with licensed insurers admitted to transact business in the State of California with a current A.M. Best’s rating of A V or better, or, if insurance is placed with a surplus lines insurer, insurer must be listed on the State of California List of Eligible Surplus Lines Insurers (LESLI) with a current A.M. Best’s rating of no less than A X. For Workers’ Compensation Insurance, insurance issued by the State Compensation Fund is also acceptable. 3.4 Subcontractors. Consultant must include all sub-consultants/sub-contractors as insureds under its policies and/or furnish separate certificates and endorsements demonstrating separate coverage for those not under its policies. Any separate coverage for sub-consultants must also comply with the terms of this Agreement. 3.5 Additional Insureds. City, its officers, officials, employees, agents, and volunteers must be named as additional insureds with respect to any policy of general liability, automobile, or pollution insurance specified as required in Exhibit B or as may otherwise be specified by City’s Risk Manager.. The general liability additional insured coverage must be provided in the form of an endorsement to the Consultant’s insurance using ISO CG 2010 (11/85) or its equivalent; such endorsement must not exclude Products/Completed Operations coverage. 3.6 General Liability Coverage to be “Primary.” Consultant’s general liability coverage must be primary insurance as it pertains to the City, its officers, officials, employees, agents, and volunteers. Any insurance or self-insurance maintained by the City, its officers, officials, employees, or volunteers is wholly separate from the insurance provided by Consultant and in no way relieves Consultant from its responsibility to provide insurance. 3.7 No Cancellation. No Required Insurance policy may be canceled by either Party during the required insured period under this Agreement, except after thirty days’prior written notice to the City by certified mail, return receipt requested. Prior to the effective date of any such cancellation Consultant must procure and put into effect equivalent coverage(s). 3.8 Waiver of Subrogation. Consultant’s insurer(s) will provide a Waiver of Subrogation in favor of the City for each Required Insurance policy under this Agreement. In addition, Consultant waives any right it may have or may obtain to subrogation for a claim against City. 3.9 Verification of Coverage. Prior to commencement of any work, Consultant shall furnish City with original certificates of insurance and any amendatory endorsements necessary to demonstrate to City that Page 70 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 Consultant has obtained the Required Insurance in compliance with the terms of this Agreement. The words “will endeavor” and “but failure to mail such notice shall impose no obligation or liability of any kind upon the company, its agents, or representatives”or any similar language must be deleted from all certificates. The required certificates and endorsements should otherwise be on industry standard forms. The City reserves the right to require, at anytime, complete, certified copies of all required insurance policies, including endorsements evidencing the coverage required by these specifications. 3.10 Claims Made Policy Requirements. If General Liability, Pollution and/or Asbestos Pollution Liability and/or Errors & Omissions coverage are required and are provided on a claims-made form, the following requirements also apply: a. The “Retro Date” must be shown, and must be before the date of this Agreement or the beginning of the work required by this Agreement. b. Insurance must be maintained, and evidence of insurance must be provided, for at least five (5) years after completion of the work required by this Agreement. c. If coverage is canceled or non-renewed, and not replaced with another claims-made policy form with a “Retro Date” prior to the effective date of this Agreement, the Consultant must purchase “extended reporting”coverage for a minimum of five (5) years after completion of the work required by this Agreement. d. A copy of the claims reporting requirements must be submitted to the City for review. 3.11 Not a Limitation of Other Obligations. Insurance provisions under this section shall not be construed to limit the Consultant’s obligations under this Agreement, including Indemnity. 3.12 Additional Coverage. To the extent that insurance coverage provided by Consultant maintains higher limits than the minimums appearing in Exhibit B, City requires and shall be entitled to coverage for higher limits maintained. 4. INDEMNIFICATION 4.1. General. To the maximum extent allowed by law, Consultant shall protect, defend, indemnify and hold harmless City, its elected and appointed officers, agents, employees and volunteers (collectively, “Indemnified Parties”), from and against any and all claims, demands, causes of action, costs, expenses, (including reasonable attorneys’fees and court costs), liability, loss, damage or injury, in law or equity, to property or persons, including wrongful death, in any manner arising out of or incident to any alleged acts, omissions, negligence, or willful misconduct of Consultant, its officials, officers, employees, agents, and contractors, arising out of or in connection with the performance of the Required Services, the results of such performance, or this Agreement. This indemnity provision does not include any claims, damages, liability, costs and expenses arising from the sole negligence or willful misconduct of the Indemnified Parties. Also covered is liability arising from, connected with, caused by or claimed to be caused by the active or passive negligent acts or omissions of the Indemnified Parties which may be in combination with the active or passive negligent acts or omissions of the Consultant, its employees, agents or officers, or any third party. 4.2. Modified Indemnity Where Agreement Involves Design Professional Services. Notwithstanding the forgoing, if the services provided under this Agreement are design professional services, as defined by Page 71 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 7 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 California Civil Code section 2782.8, as may be amended from time to time, the defense and indemnity obligation under Section 1, above, shall be limited to th e extent required by California Civil Code section 2782.8. 4.3 Costs of Defense and Award. Included in Consultant’s obligations under this Section 4 is Consultant’s obligation to defend, at Consultant’s own cost, expense and risk, any and all suits, actions or other legal proceedings that may be brought or instituted against one or more of the Indemnified Parties. Subject to the limitations in this Section 4, Consultant shall pay and satisfy any judgment, award or decree that may be rendered against one or more of the Indemnified Parties for any and all related legal expenses and costs incurred by any of them. 4.4. Consultant’s Obligations Not Limited or Modified.Consultant’s obligations under this Section 4 shall not be limited to insurance proceeds, if any, received by the Indemnified Parties, or by any prior or subsequent declaration by the Consultant. Furthermore,Consultant’s obligations under this Section 4 shall in no way limit, modify or excuse any of Consultant’s other obligations or duties under this Agreement. 4.5. Enforcement Costs. Consultant agrees to pay any and all costs City incurs in enforcing Consultant’s obligations under this Section 4. 4.6 Survival. Consultant’s obligations under this Section 4 shall survive the termination of this Agreement. 5. FINANCIAL INTERESTS OF CONSULTANT. 5.1 Form 700 Filing. The California Political Reform Act and the Chula Vista Conflict of Interest Code require certain government officials and consultants performing work for government agencies to publicly disclose certain of their personal assets and income using a Statement of Economic Interests form (Form 700). In order to assure compliance with these requirements, Consultant shall comply with the disclosure requirements identified in the attached Exhibit C,incorporated into the Agreement by this reference. 5.2 Disclosures; Prohibited Interests. Independent of whether Consultant is required to file a Form 700, Consultant warrants and represents that it has disclosed to City any economic interests held by Consultant, or its employees or subcontractors who will be performing the Required Services, in any real property or project which is the subject of this Agreement. Consultant warrants and represents that it has not employed or retained any company or person, other than a bona fide employee or approved subcontractor working solely for Consultant, to solicit or secure this Agreement. Further, Consultant warrants and represents that it has not paid or agreed to pay any company or person, other than a bona fide employee or approved subcontractor working solely for Consultant, any fee, commission, percentage, brokerage fee, gift or other consideration contingent upon or resulting from the award or making of this Agreement. Consultant further warrants and represents that no officer or employee of City, has any interest, whether contractual, non- contractual, financial or otherwise, in this transaction, the proceeds hereof, or in the business of Consultant or Consultant’s subcontractors. Consultant further agrees to notify City in the event any such interest is discovered whether or not such interest is prohibited by law or this Agreement. For breach or violation of any of these warranties, City shall have the right to rescind this Agreement without liability. 6. REMEDIES 6.1 Termination for Cause. If for any reason whatsoever Consultant shall fail to perform the Required Services under this Agreement, in a proper or timely manner, or if Consultant shall violate any of the other Page 72 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 8 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 covenants, agreements or conditions of this Agreement (each a “Default”), in addition to any and all other rights and remedies City may have under this Agreement, at law or in equity, City shall have the right to terminate this Agreement by giving five (5) days written notice to Consultant. Such notice shall identify the Default and the Agreement termination date. If Consultant notifies City of its intent to cure such Default prior to City’s specified termination date, and City agrees that the specified Default is capable of being cured, City may grant Consultant up to ten (10) additional days after the designated termination date to effectuate such cure. In the event of a termination under this Section 6.1, Consultant shall immediately provide City any and all ”Work Product”(defined in Section 7 below) prepared by Consultant as part of the Required Services. Such Work Product shall be City’s sole and exclusive property as provided in Section 7 hereof. Consultant may be entitled to compensation for work satisfactorily performed prior to Consultant’s receipt of the Default notice; provided, however, in no event shall such compensation exceed the amount that would have been payable under this Agreement for such work, and any such compensation shall be reduced by any costs incurred or projected to be incurred by City as a result of the Default. 6.2 Termination or Suspension for Convenience of City. City may suspend or terminate this Agreement, or any portion of the Required Services, at any time and for any reason, with or without cause, by giving specific written notice to Consultant of such termination or suspension at least fifteen (15) days prior to the effective date thereof. Upon receipt of such notice, Consultant shall immediately cease all work under the Agreement and promptly deliver all “Work Product”(defined in Section 7 below) to City. Such Work Product shall be City's sole and exclusive property as provided in Section 7 hereof. Consultant shall be entitled to receive just and equitable compensation for this Work Product in an amount equal to the amount due and payable under this Agreement for work satisfactorily performed as of the date of the termination/suspension notice plus any additional remaining Required Services requested or approved by City in advance that would maximize City’s value under the Agreement. 6.3 Waiver of Claims. In the event City terminates the Agreement in accordance with the terms of this Section, Consultant hereby expressly waives any and all claims for damages or compensation as a result of such termination except as expresslyprovided in this Section 6. 6.4 Administrative Claims Requirements and Procedures. No suit or arbitration shall be brought arising out of this Agreement against City unless a claim has first been presented in writing and filed with City and acted upon by City in accordance with the procedures set forth in Chapter 1.34 of the Chula Vista Municipal Code, as same may be amended, the provisions of which, including such policies and procedures used by City in the implementation of same, are incorporated herein by this reference. Upon request by City, Consultant shall meet and confer in good faith with City for the purpose of resolving any dispute over the terms of this Agreement. 6.5 Governing Law/Venue. This Agreement shall be governed by and construed in accordance with the laws of the State of California. Any action arising under or relating to this Agreement shall be brought only in San Diego County, State of California. 6.6 Service of Process. Consultant agrees that it is subject to personal jurisdiction in California. If Consultant is a foreign corporation, limited liability company, or partnership that is not registered with the California Secretary of State, Consultant irrevocably consents to service of process on Consultant by first class mail directed to the individual and address listed under “For Legal Notice,”in section 1.B. of Exhibit A to this Agreement, and that such service shall be effective five days after mailing. Page 73 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 9 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 7. OWNERSHIP AND USE OF WORK PRODUCT All reports, studies, information, data, statistics, forms, designs, plans, procedures, systems and any other materials or properties produced in whole or in part under this Agreement in connection with the performance of the Required Services (collectively “Work Product”) shall be the sole and exclusive property of City. No such Work Product shall be subject to private use, copyrights or patent rights by Consultant in the United States or in any other country without the express, prior written consent of City. City shall have unrestricted authority to publish, disclose, distribute, and otherwise use, copyright or patent, in whole or in part, any such Work Product, without requiring any permission of Consultant, except as may be limited by the provisions of the Public Records Act or expressly prohibited by other applicable laws. With respect to computer files containing data generated as Work Product, Consultant shall make available to City, upon reasonable written request by City, the necessary functional computer software and hardware for purposes of accessing, compiling, transferring and printing computer files. 8. GENERAL PROVISIONS 8.1 Amendment. This Agreement may be amended, but only in writing signed by both Parties. 8.2 Assignment. City would not have entered into this Agreement but for Consultant’s unique qualifications and traits. Consultant shall not assign any of its rights or responsibilities under this Agreement, nor any part hereof, without City’s prior written consent, which City may grant, condition or deny in its sole discretion. 8.3 Authority. The person(s) executing this Agreement for Consultant warrants and represents that they have the authority to execute same on behalf of Consultant and to bind Consultant to its obligations hereunder without any further action or direction from Consultant or any board, principle or officer thereof. 8.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed an original, but all of which shall constitute one Agreement after each Party has signed such a counterpart. 8.5 Entire Agreement. This Agreement together with all exhibits attached hereto and other agreements expressly referred to herein, constitutes the entire Agreement between the Parties with respect to the subject matter contained herein. All exhibits referenced herein shall be attached hereto and are incorporated herein by reference. All prior or contemporaneous agreements, understandings, representations, warranties and statements, oral or written, are superseded. 8.6 Record Retention. During the course of the Agreement and for three (3) years following completion of the Required Services, Consultant agrees to maintain, intact and readily accessible, all data, documents, reports, records, contracts, and supporting materials relating to the performance of the Agreement, including accounting for costs and expenses charged to City, including such records in the possession of sub- contractors/sub-consultants. 8.7 Further Assurances. The Parties agree to perform such further acts and to execute and deliver such additional documents and instruments as may be reasonably required in order to carry out the provisions of this Agreement and the intentions of the Parties. 8.8 Independent Contractor. Consultant is and shall at all times remain as to City a wholly independent contractor. Neither City nor any of its officers, employees, agents or volunteers shall have control over the conduct of Consultant or any of Consultant’s officers, employees, or agents (“Consultant Related Page 74 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 10 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 Individuals”), except as set forth in this Agreement. No Consultant Related Individuals shall be deemed employees of City, and none of them shall be entitled to any benefits to which City employees are entitled, including but not limited to, overtime, retirement benefits, worker's compensation benefits, injury leave or other leave benefits. Furthermore, City will not withhold state or federal income tax, social security tax or any other payroll tax with respect to any Consultant Related Individuals; instead, Consultant shall be solely responsible for the payment of same and shall hold the City harmless with respect to same. Consultant shall not at any time or in any manner represent that it or any of its Consultant Related Individuals are employees or agents of City. Consultant shall not incur or have the power to incur any debt, obligation or liability whatsoever against City, or bind City in any manner. 8.9 Notices. All notices, demands or requests provided for or permitted to be given pursuant to this Agreement must be in writing. All notices, demands and requests to be sent to any Party shall be deemed to have been properly given or served if personally served or deposited in the United States mail, addressed to such Party, postage prepaid, registered or certified, with return receipt requested, at the addresses identified in this Agreement at the places of business for each of the designated Parties as indicated in Exhibit A, or otherwise provided in writing. (End of page. Next page is signature page.) Page 75 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 11 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 ________________ ________________ SIGNATURE PAGE CONSULTANT SERVICES AGREEMENT IN WITNESS WHEREOF, by executing this Agreement where indicated below, City and Consultant agree that they have read and understood all terms and conditions of the Agreement, that they fully agree and consent to bound by same, and that they are freely entering into this Agreement as of the Effective Date. SCG - SPICER CONSULTING GROUP, LLC CITY OF CHULA VISTA BY:BY: Shane Spicer JOHN MCCANN Managing Director MAYOR ATTEST BY: Kerry K. Bigelow, MMC CityClerk APPROVED AS TO FORM BY: Jill D.S. Maland Lounsbery Ferguson Altona & Peak LLP Acting City Attorney Page 76 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 12 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 EXHIBIT A SCOPE OF WORK AND PAYMENT TERMS 1. Contact People for Contract Administration and Legal Notice A. CityContract Administration: Patricia Macias 276 Fourth Avenue Chula Vista, CA 91910 619-409-5916 PMacias@chulavistaca.gov For Legal Notice Copy to: Cityof Chula Vista City Attorney 276 Fourth Avenue, Chula Vista, CA 91910 619-691-5037 CityAttorney@chulavistaca.gov B. Consultant Contract Administration: SCG - SPICER CONSULTING GROUP, LLC 41880 Kalmia Street, Suite 145, Murrieta CA 92562 (951) 208-7870 Shane.spicer@spicercg.com For Legal Notice Copy to: SCG –Spicer Consulting Group, LLC Shane Spicer, Managing Director 41880 Kalmia Street, Suite 145, Murrieta CA 92562 (951) 208-7870 Shane.spicer@spicercg.com 2. Required Services A. General Description: 1. To provide Special Tax Consultant Services for: Assessment Districts (ADs), CommunityFacilities Districts (CFDs), Open Space Districts (OSDs), and Annual Sewer Assessment Administration Services. 2. To provide arbitrage calculations and continuing disclosure services for land-based and non-land-based bonds, including Pension Obligation Bonds (POBs) and other future issuances that may be created throughout the term of the Agreement. 3. To provide district formation and district modification services as needed. Page 77 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 13 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 B. Detailed Description: Consultant shall perform the following services: Scope of Work Assessment District Administration and Apportionment Services x Apportion of tax lien for each parcel within the assessment district according to the method of spread in the Engineer’s Report x Provide assessment installment information for each parcel for submittal in a timelymanner to the County of San Diego for placement on the property tax roll. The information shall be submitted on the media, format, and configuration specified by the County; x Research and resubmit entries rejected bythe Countyon behalf of the City; x Provide staffing and contact information to field inquiries concerning Assessment District administration, assessments, payoff calculation, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; x Prepare an annual levyreport summarizing the information used to calculate the annual installment amount for the district, including a list of all Assessor Parcel Numbers; x Prepare and record the amended assessment diagrams that result from lot splits or subdivision; x Provide support to Citystaff in researching current and historical tax roll information, ownership, payoff calculation, delinquencynotices and delinquent status from the County tax system; x Prepare continuing disclosure reports and event notices for City staff review, as required bydistrict disclosure agreements and SEC Rule 15c2-12, and disseminate approved documents to the Electronic Municipal Market Access (EMMA); x Provide support to Citystaff to maintain compliance with the requirements of State of California Revenue and Taxation Code 163; x Perform required bond call spreads in accordance with applicable state laws and coordinate the early redemption of outstanding bonds as needed; x Provide certification related to specific escrow release tests on as needed basis; x Assist Citystaff in delinquencymanagement byclosel ymonitoring outstanding district delinquencies, and provide periodic reports to the Citypresenting aging and current statuses of all delinquent installments; x Provide Arbitrage Calculations at least every five years for each bond issue as well as a final computation on the date on which the last maturity of a bond issue is retired; x Provide Asset Management Services including the ability to estimate future capital asset replacement, as required by staff; x Assist Citywith new Assessment District formations; and x All other special projects as deemed necessary, including but not limited to refunding analysis. Community Facilities District – Bonded •Review the special tax schedules prepared bythe Cityand ensure that all debt service and administrative expenses are recovered through the annual special tax levies; •Calculate the annual special tax levyfor each parcel within the CFD following the guidelines established in the Rate and Method of Apportionment of Special Tax; •Prepare comprehensive special tax installment information for each parcel for submittal in a timely manner to the Countyof San Diego for placement on the propertytax roll. This information shall be submitted on the media, format, and configuration specified bythe County; • Research and resubmit entries rejected bythe Countyon behalf of the City; Page 78 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 14 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 •Provide staffing and contact information to field inquiries concerning CFD administration, annual special taxes, payoff calculation, and other information regarding district proceedings and annual installments for propertyowners, title companies and other interested parties; •Prepare an annual levyreport summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; •Assist Citystaff with proper disclosure of special tax information for prospective propertypurchases as required bySections 53340.2(b) and 53341.5 of the State of California Government Code; •Prepare continuing disclosure reports and event notices for City staff review, as required bydistrict disclosure agreements and SEC Rule 15c2-12, and disseminate approved documents to the Electronic Municipal Market Access (EMMA); •Perform tasks associated with CFD administration, including but not limited to bond call coordination, release of lien, delinquencyreporting, foreclosure coordination, and annexation; • Assist Citystaff in providing information to bond rating agencies when needed; • Assist in maintaining current and future CFD law and regulation compliance and notify Citystaff of anypertinent changes in CFD law and regulations; • Provide certification related to specific escrow release tests on as needed basis; • Assist Citystaff in delinquencymanagement by closelymonitoring outstanding district delinquencies, and provide periodic reports to the Citypresenting aging and current statuses of all delinquent installments; •Provide Arbitrage Calculations at least every five years for each bond issue as well as a final computation on the date on which the last maturity of a bond issue is retired; •Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff; •All other special projects as deemed necessary, including but not limited to new district formation, tax rate projection, and refunding analysis. Community Facilities District –Maintenance (Non-Bonded) •Calculate the annual special tax levyfor each parcel within the CFD following the guidelines established in the Rate and Method of Apportionment of Special Tax; •Prepare comprehensive special tax installment information for each parcel for submittal in a timely manner to the County of San Diego for placement on the propertytax roll. The information shall be submitted on the media, format, and configuration specified bythe County; • Research and resubmit entries rejected bythe Countyon behalf of the City; • Provide staffing and contact information to field inquiries concerning CFD administration, annual special taxes, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; • Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; •Assist Citystaff with proper disclosure of assessment information for prospective propertypurchases as required bySections 53340.2(b) and 53341.5 of the State of California Government Code; • Provide annexation services to all subject developments, boundarymap recordation, annexation proceedings, such as public hearing and owner election, and Preparation of rates and Method of Apportionment for annexations, data collection, etc.; • Administration and assistance with compliance requirements; •Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff; • Assist City with new District formations; and • All other special projects as deemed necessary, including but not limited to revenue projection and cash flow forecast. Page 79 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 15 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 Open Space Maintenance Districts •Obtain thorough understanding of the City’s OSD establishment, their boundaries, Parcels and particularities; •Review all documentation, databases, and budgets prior to preparing levy analysis, in order to ensure total and complete equityof assessments within each district; • Prepare complete documentation for annual assessment, including Engineer’s Reports and maps; • Attend City Council meetings with OSD-related items, as requested by City staff; •Provide comprehensive assessment installment information for each parcel and submit in a timely manner to the County of San Diego for placement on the propertytax roll. The information shall be submitted on the media, format and configuration specified bythe County; • Research and resubmit entries rejected bythe Countyon behalf of the City; • Provide staffing and contact information to field inquiries concerning OSD administration, annual assessments, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; • Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; •Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff, and • Complete all reports on OSD required bythe state and federal agencies. Montgomery Sewer District •Obtain thorough understanding of the Montgomery Sewer District, its boundaries, Parcels, and particularities of the district; •Review all documentation, databases, and budgets prior to preparing levy analysis, in order to ensure total and complete equityof assessments the district; • Work with water agencies and download data from them to determine usage; • Update sewer and meter rate tables with rate updates from the prior year; • Match new accounts to APNs (usually around 2 dozen new accounts/per year); • Run initial assessment, and research zero ($0) assessment parcels; • Provide database/workbook to City Finance Staff to perform second levy check; • Provide comprehensive assessment installment information for each parcel and submit in a timely manner to the County of San Diego for placement on the propertytax roll. The information shall be submitted on the media, format and configuration specified bythe County; • Research and resubmit entries rejected bythe Countyon behalf of the City; • Provide staffing and contact information to field inquiries concerning the district administration, annual assessments, and other information regarding district proceedings and annual installments for propertyowners, title companies and other interested parties; • Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; and • Complete all reports on the district required bythe state and federal agencies. Non-Land Based Bonds x Prepare continuing disclosure reports and event notices for City staff review, as required by the bond indenture and SEC Rule 15c2-12.,and disseminate approved documents to the Electronic Municipal Market Access (EMMA); Page 80 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 x Provide Arbitrage Calculations at least every five years for each bond issue as well as a final computation on the date on which the last maturity of a bond issue is retired; Community Facilities District (16-I IA2/Bayfront) x Review the special tax schedules prepared by the City and ensure that all debt service and administrative expenses are recovered through the annual special tax levies. x Calculate the annual special tax levy for each parcel within the CFD following the guidelines established in the Rate and Method of Apportionment of Special Tax; x Prepare comprehensive special tax installment information for each parcel for submittal in a timely manner to the County of San Diego for placement on the property tax roll. This information shall be submitted on the media, format, and configuration specified by the County; x Research and resubmit entries rejected by the County on behalf of the City; x Provide staffing and contact information to field inquiries concerning CFD administration, annual special taxed, payoff calculation, and other information regarding district proceedings and annual installments for property owners, title companies and other interested parties; x Prepare an annual levy report summarizing the information used to calculate the annual installment amount for the districts, including a list of all Assessor Parcel Numbers; x Assist City staff with proper disclosure of special tax information for prospective property purchases as required by Sections 53340.2(b) and 53341.5 of the State of California Government Code; x Prepare continuing disclosure reports and event notices for City staff review, as required by district disclosure agreements and SEC Rule 15c2-12, and disseminate approved documents to the Electronic Municipal Market Access (EMMA); x Perform tasks associated with CFD administration, including but not limited to bond call coordination, release of lien, delinquency reporting, foreclosure coordination, and annexation; x Assist City staff in providing information to bond rating agencies when needed; x Assist in maintaining current and future CFD law and regulation compliance and notify City staff of any pertinent changes in CFD law and regulations; x Provide certification related to specific escrow release tests on an as needed basis; x Assist City staff in delinquency management by closely monitoring outstanding district delinquencies, and provide periodic reports to the City presenting aging and current statuses of all delinquent installments; x Provide Arbitrage Calculations at least every five years for each bond issue as well as a final computation on the date on which the last maturity of a bond issue is retired; x Provide Asset Management Services including the ability to estimate future capital asset replacement, as requested by staff; x All other special projects as deemed necessary, including but not limited to new district formation, tax rate projection, and refunding analysis. 3. Term:In accordance with Section 1.10 of this Agreement, the term of this Agreement shall begin April 01, 2018 and end on September 30, 2023 for completion of all Required Services. 4. Compensation: A. Form of Compensation ܈ Single Fixed Fee. For performance of all the Required Services by Consultant as herein required, City shall pay a single fixed fee of $1,037,243.00, upon completion of all Required Services to City’s satisfaction. Page 81 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 17 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 B. Reimbursement of Costs ܈ None, the compensation includes all costs 5. Special Provisions: ܆ Permitted Sub-Consultants: None ܆ Security for Performance:“None” ܆ Notwithstanding the completion date set forth in Section 3 above, City has option to extend this Agreement for Insert Number of Terms additional terms, defined as a one-year increment or Enter a Specific Date. if applicable. The City Manager or Director of Finance/Treasurer shall be authorized to exercise the extensions on behalf of the City. If the City exercises an option to extend, each extension shall be on the same terms and conditions contained herein, provided that the amounts specified in Section 4 above may be increased by up to Insert Percentage of Increase or Actual Dollar Amount for each extension. The City shall give written notice to Consultant of the City’s election to exercise the extension via the Notice of Exercise of Option to Extend document. ܈ None Page 82 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 18 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 EXHIBIT B INSURANCE REQUIREMENTS Consultant shall adhere to all terms and conditions of Section 3 of the Agreement and agrees to provide the following types and minimum amounts of insurance, as indicated by checking the applicable boxes (x). Type of Insurance Minimum Amount Form ܈ General Liability:$2,000,000 per occurrence for Insurance Services Office Form Including products and bodily injury, personal injury CG 00 01 completed operations,(including death), and property personal and damage. If Commercial General advertising injury Liability insurance with a general aggregate limit is used, either the general aggregate limit must apply separately to this Agreement or the general aggregate limit must be twice the required occurrence limit Additional Insured Endorsement or Blanket AI Endorsement for City* *Must be primary and must not exclude Products/Completed Operations Waiver of Recovery Endorsement ܈ Automobile Liability $1,000,000 per accident for bodily Insurance Services Office Form CA 00 01 Code 1-Any Auto Code 8-Hired Code 9-Non Owned injury, including death, and property damage ܈ Workers’$1,000,000 each accident $1,000,000 disease policy limit $1,000,000 disease each employee Waiver of Recovery Endorsement Compensation Employer’s Liability ܈ Professional Liability $1,000,000 each occurrence $2,000,000 aggregate(Errors & Omissions) Other Negotiated Insurance Terms: NONE Page 83 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 19 City of Chula Vista Agreement No.: 2023-067 Consultant Name: SCG - Spicer Consulting Group, LLC Rev. 04/26/2023 EXHIBIT C CONSULTANT CONFLICT OF INTEREST DESIGNATION The Political Reform Act 2 and the Chula Vista Conflict of Interest Code 3 (“Code”) require designated state and local government officials, including some consultants, to make certain public disclosures using a Statement of Economic Interests form (Form 700). Once filed, a Form 700 is a public document, accessible to any member of the public. In addition, consultants designated to file the Form 700 are also required to comply with certain ethics training requirements.4 ܈ A. Consultant IS a corporation or limited liability company and is therefore EXCLUDED 5 from disclosure. ܆ B. Consultant NOT a corporation or limited liability company and disclosure designation is as follows: APPLICABLE DESIGNATIONS FOR INDIVIDUAL(S) ASSIGNED TO PROVIDE SERVICES (Category descriptions available at www.chulavistaca.gov/departments/city-clerk/conflict-of-interest-code.) Name Email Address Applicable Designation Shane Spicer Shane.spicer@spicercg.com ܆ A. Full Disclosure Jonathan Short Jonathan.short@spicercg.com ܆ B. Limited Disclosure (select one or more of the categoriesunder which the consultantshall file): ܆ 1. ܆ 2. ܆ 3. ܆ 4. ܆ 5. ܆ 6. ܆ 7. Justification: ܈ C. Excluded from Disclosure 1.Required Filers Each individual who will be performing services for the City pursuant to the Agreement and who meets the definition of “Consultant,” pursuant to FPPC Regulation 18700.3, must file a Form 700. 2.Required Filing Deadlines Each initial Form 700 required under this Agreement shall be filed with the Office of the City Clerk via the City's online filing system, NetFile, within 30 days of the approval of the Agreement. Additional Form 700 filings will be required annually on April 1 during the term of the Agreement, and within 30 days of the termination of the Agreement. 3. Filing Designation The City Department Director will designate each individual who will be providing services to the City pursuant to the Agreement as full disclosure, limited disclosure,or excluded from disclosure, based on an analysis of the services the Consultant will provide. Notwithstanding this designation or anything in the Agreement, the Consultant is ultimately responsible for complying with FPPC regulations and filing requirements. If you have any questions regarding filing requirements, please do not hesitate to contact the City Clerk at (619)691-5041, or the FPPC at 1- 866-ASK-FPPC, or (866) 275-3772 *2. Pursuant to the duly adopted City of Chula Vista Conflict of Interest Code, this document shall serve as the written determination of the consultant’s requirement to comply with the disclosure requirements set forth in the Code. Completed by: Patricia Macias 2 Cal. Gov. Code §§81000 et seq.; FPPC Regs. 18700.3 and 18704. 3 Chula Vista Municipal Code §§2.02.010-2.02.040. 4 Cal. Gov. Code §§53234,et seq. 5 CA FPPC Adv. A-15-147 (Chadwick) (2015);Davis v. Fresno Unified School District (2015) 237 Cal.App.4 th 261; FPPC Reg. 18700.3 (Consultant defined as an “individual”who participates in making a governmental decision;“individual”does not include corporationor limited liability company). Page 84 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda v.003 Page | 1 May 16, 2023 ITEM TITLE Open Space Districts: Initiate Proceedings, Approve the Engineer’s Report, Declare the Intention to Levy and Collect Assessments for the Open Space Districts for Fiscal Year 2023-24, and Set a Public Hearing Report Number: 23-0077 Location: No specific geographic location. Department: Finance Environmental Notice: The activity is not a "Project" as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. Recommended Action Adopt resolutions A) Initiating proceedings for the levy and collection of assessments for Fiscal Year 2023/24 for Open Space Districts 1 through 11, 14, 15, 17, 18, 20, 23, 24, 26, 31, 33, Eastlake, Town Centre Maintenance District, and Bay Boulevard pursuant to the Landscaping and Lighting Act of 1972; B) Approving the Engineer’s Report, declaring the intention to levy and collect assessments; and setting a public hearing for July 11, 2023, regarding the Fiscal Year 2023/24 assessments for Open Space Districts 2 through 10, 14, 15, 17, 18, 20 (Zones 1 through 6, 8, And 9), 23, 24, 26, 31, 33, Eastlake Maintenance District No 1, Town Centre Maintenance District, and Bay Boulevard Maintenance District; C) Approving the Engineer’s Report, declaring the intention to levy and collect assessments; and setting a public hearing for July 11, 2023, regarding the Fiscal Year 2023/24 assessments for Open Space District 1 and Open Space District 20 Zone 7; and D) Approving the Engineer’s Report, declaring the intention to levy and collect assessments; and setting a public hearing for July 11, 2023, regarding the Fiscal Year 2023/24 assessments for Open Space District 11. SUMMARY The City administers and maintains 36 Open Space Districts and associated zones that have been established over the last 30 years. The Open Space Districts provide a financing mechanism to maintain the public open space areas associated with each specific development. The City Council’s approval of the levy is required by the first week of August in order to meet the annual deadline established by the San Diego County Auditor- Controller. This item represents the initial step in an annual two-step process. Specifically, it declares the intention to levy and collect assessments, approves the Fiscal Year 2023-24 Engineer’s Report, and sets the Page 85 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 2 date of the public hearing, which is step two in the annual process. These efforts provide for the levy of assessments to provide maintenance services, as detailed below and ensures that the County Auditor- Controller deadlines are met for all of the City’s Open Space Districts and their associated zones. ENVIRONMENTAL REVIEW The Director of Development Services has reviewed the proposed activity for compliance with the California Environmental Quality Act (CEQA) and has determined that the activity is not a “Project” as defined under Section 15378 of the State CEQA Guidelines because the proposed activity consists of reporting and creating governmental fiscal/funding mechanism which does not result in a physical change in the environment; therefore, pursuant to Section 15060(c)(3) of the State CEQA Guidelines, the activity is not subject to CEQA. Thus, no environmental review is required. BOARD/COMMISSION/COMMITTEE RECOMMENDATION Not applicable. DISCUSSION Open Space Districts (OSDs) were established in conjunction with each development to ensure a financing mechanism was available for the funding of perpetual maintenance of common open space areas. The City levies annual assessments within each OSD to cover the costs of maintenance associated with each OSD area of maintenance. Once City Council approves the annual assessments, they are sent to the County for inclusion on the secured property tax bills of each affected parcel. Each year the City Council must take two actions before levying the annual assessments. Tonight’s item is the first step and includes Council approval of the Engineer’s Report on Open Space Districts, declaration of the City's intention to levy the annual assessments and setting of the date and time for a public hearing. The second action, scheduled for July 11, 2023, is holding a public hearing, consideration of public testimony, authorization to levy annual assessments and confirmation of the amount to be collected. Pursuant to state law and Municipal Code, the City Engineer has prepared and filed the annual report for all existing Open Space Districts. The report is attached as Exhibit 3 to this agenda statement. Exhibit 1 lists the names and locations of the Districts. The annual report allows Council to review the history of the Open Space Districts. The report includes information regarding: The proposed budgets Funds remaining in the account The proposed assessment (based upon prior year assessment plus an inflation factor) The collectible (the amount needed from each property owner to provide sufficient funds for the following fiscal year’s maintenance) Improvements and Services The facilities and items to be maintained by the Open Space Districts currently consist and will remain, in general, of the following: Page 86 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 3 Irrigation Fertilization Aerification Pest Control Insect infestation control Removal of weeds, trash and litter Removal of noxious plant material Trail maintenance Public walkway cleaning Low flow and brow channel maintenance Weed abatement Slopes and Canyons Pedestrian light maintenance Signage within trails/canyons Pruning of trees and shrubs Repair of irrigation equipment Irrigation equipment upgrades Brush clearance Encroachment trims Fencing maintenance Replacement of dead or diseased plant material Retaining walls Assessments & Collectibles The City of Chula Vista Municipal Code makes the distinction between the assessment and the amount that the City may collect against the assessment (the “Collectible”). Each year, the prior year’s maximum assessment amount is adjusted by an inflation factor, pursuant to the Municipal Code. This inflation factor is based upon the lower of two inflation factors: 1) the San Diego Metropolitan Consumer Price Index (CPI), and 2) the Governor’s California 4th Quarter per Capita Personal Income Index. In the mid-1990’s (and for all Open Space Districts established after that date), Council approved the assessments with an inflation factor. Since that date, Council may annually adjust the assessment by this inflation factor without this adjustment being construed as an increase, and thus being subject to an OSD balloting, per Proposition 218. The assessments for FY 2023-24 are proposed at the FY 2022-23 amounts adjusted by the inflation factor of 4.26% pursuant to the Municipal Code. This index is the lower of the two inflation factors mentioned above and represents the percentage change in the Governor’s California 4th Quarter per Capita Personal Income Index. The Collectible is the amount to actually be collected from the property owner and is equal to, or lower than, the proposed assessment. The Collectible is based on the budget, the reserve requirement for operating and asset replacement activities, prior year’s savings and fund balance, and interest income. Illustrated in Exhibit 2 are the proposed Assessments and Collectibles for FY 2023-24. The proposed FY 2023-24 Collectibles per EDU are preliminary and will be updated with actual amounts at the public hearing on July 11, 2023. The current amounts in the table are based upon estimated fund balances and EDUs at this time. The Collectibles per EDU are set at the Assessment per EDU to allow for the collection of up to the maximum amount allowable. Town Centre LMD: A downtown Property and Business Improvement District (PBID) replaced Town Centre Landscape Maintenance District (LMD) in 2001. At that time, it was anticipated that the Town Centre LMD would be dissolved. However, the City determined that there was some potential long-term exposure for the City based on the remote possibility that the current PBID might not receive sufficient support for re- approval in the future. If the PBID was not re-approved at some future date, and if the Town Centre LMD was dissolved, there would no longer be a funding mechanism for downtown landscape maintenance. Page 87 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 4 Based on this possibility, the Town Centre LMD remains open as a “contingent” district. This means that the City will set the maximum assessment amount for the District on an annual basis, even though property owners will not be billed any sum on the tax roll. Should the PBID not be re-approved, the Town Centre LMD will be in place to provide the necessary funding mechanism for downtown landscape maintenance. The current PBID was renewed with the adoption of Council Resolution No. 2016-122, for a period of ten (10) years. Given this, the Town Centre LMD will remain a “contingent” district. Standard Notice Process for Annual Levy Upon approval by City Council, the public hearing will be noticed pursuant to Government Code 6061, which requires that a notice be published in a newspaper of general circulation at least 10 days before the public hearing. Tonight’s resolution approves this report and sets the date and time for a public hearing to consider the levy of assessments and the collection of the funds. DECISION-MAKER CONFLICT Staff has reviewed the property holdings of the City Council and has found that Mayor McCann has real property holdings within 500 feet of the boundaries of Open Space District 1 and Open Space District 20 Zone 7 which is the subject of Resolution C of this action. Consequently, pursuant to California Code of Regulations Title 2, sections 18700 and 18702.2(a)(7), this item presents a disqualifying real property-related financial conflict of interest under the Political Reform Act (Cal. Gov't Code § 87100, et seq.) for the above-identified member. Staff has reviewed the property holdings of the City Council and has found that, Councilmember Preciado has real property holdings within 1,000 feet, but beyond 500 feet, of Open Space District 11 which is the subject of Resolution D this action. Staff has determined that the decision would change the parcel’s development potential, income-producing potential, highest and best use, character, and/or market value. Consequently, pursuant to California Code of Regulations Title 2, sections 18700 and 18702.2(a)(8), this item presents a disqualifying real property-related financial conflict of interest under the Political Reform Act (Cal. Gov't Code § 87100, et seq.) for the above-identified member. Staff is not independently aware and has not been informed by any City Council member, of any other fact that may constitute a basis for a decision-maker conflict of interest in this matter. CURRENT-YEAR FISCAL IMPACT There is no direct ongoing fiscal impact to the General Fund or any other funds by this action, since the proposed levies are effective in Fiscal Year 2023-24. ONGOING FISCAL IMPACT For Fiscal Year 2023-24, the full cost of providing landscape maintenance services in the Open Space Districts totals $3,856,100. In addition to the landscape maintenance services costs, $260,900 in planned projects will be included. All landscape maintenance costs and planned project expenditures are recovered through the Page 88 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 5 OSD Collectibles and reserves of each Open Space District will be included in the Fiscal Year 2023-24 Budget. Given this, there is no direct fiscal impact to the General Fund. ATTACHMENTS 1. Exhibit 1 (Table 1. Open Space Districts within the City of Chula Vista) 2. Exhibit 2 (FY 2023-24 Proposed Assessments and Collectibles) 3. Exhibit 3 (FY 2023-24 Chula Vista OSD Preliminary Engineers Report) Staff Contact: Sarah Schoen, Director of Finance/Treasurer Page 89 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. 2023-______ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA INITIATING PROCEEDINGS FOR THE LEVY AND COLLECTION OF ASSESSMENTS FOR FISCAL YEAR 2023-24 FOR OPEN SPACE DISTRICTS 1 THROUGH 11, 14, 15, 17, 18, 20, 23, 24, 26, 31, 33, EASTLAKE, TOWN CENTRE, AND BAY BOULEVARD OF THE CITY OF CHULA VISTA PURSUANT TO THE LANDSCAPING AND LIGHTING ACT OF 1972 WHEREAS, the City Council has by previous Resolutions formed and levied annual assessments within the Chula Vista Open Space Districts 1 thru 11, 14, 15, 17, 18, 20, 23, 24, 26, 31, 33, Eastlake, Town Centre, and Bay Boulevard (hereafter referred to as the “Districts”), pursuant to the provisions of the Landscape and Lighting Act of 1972, Part 2, Division 15 of the California Streets and Highways Code (commencing with Section 22500) (hereafter referred to as the “Act”) and the Chula Vista Municipal Code Chapter 17.07 to pay for the maintenance and servicing of all improvements and facilities related thereto; and WHEREAS, all District and Zones of the Open Space District are attached hereto as Attachment A; and WHEREAS, Section 22622 of the Streets and Highways Code requires the City Council to adopt a resolution that: (a) generally describes any proposed new improvements or any substantial changes in existing improvements within the Open Space Districts; and (b) orders the preparation and filing of an Engineer’s Report (hereinafter the “Report”) prepared in accordance with Article 4 (commencing with Section 22565) of the Streets and Highways Code for the assessments which are proposed to be levied on assessable lots and parcels of land within the Open Space Districts for the 2023-24 Fiscal Year; and WHEREAS, the City Council has retained Spicer Consulting Group LLC, for the purpose of assisting with the Annual Levy of the District, and to prepare and file a report with the City Clerk in accordance with the Act. NOW, THEREFORE BE IT RESOLVED, FOUND, DETERMINED, AND ORDERED BY THE CITY COUNCIL FOR THE CITY OF CHULA VISTA AS FOLLOWS: Section 1. Recitals The Recitals set forth above are true and correct. Section 2. Annual Levy Report The City Council hereby orders Spicer Consulting Group LLC, to prepare and file with the City Clerk the Engineer’s Annual Levy Report concerning the levy and collection of assessments for the District for the Fiscal Year commencing July 1, 2023, and ending June 30, 2024, in accordance with Article 4 (commencing with Section 22565) of Chapter 1 of the Act. Page 90 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Section 3. District Improvements The facilities and items to be maintained by the Open Space Districts currently consist and will remain, in general, of the following: irrigation, aerification, insect infestation control, removal of noxious plant material, public walkway cleaning, weed abatement, pedestrian light maintenance, pruning of trees and shrubs, irrigation equipment upgrades, encroachment trims, replacement of dead or diseased plant material, fertilization, pest control, removal of weeds, trash and liter, trail maintenance, low flow and brow channel maintenance, slopes and canyons, signage within trails/canyons, repair of irrigation equipment, brush clearance, fencing maintenance, and retaining walls, pursuant to Sections 22565 through 22574 of the Streets and Highways Code. Services provided include all necessary service, operations, administration and maintenance required to keep the above-mentioned improvements in a healthy, vigorous and satisfactory working condition. There are no proposed new improvements or substantial changes to existing improvements within the Open Space Districts. Section 4. Severability That the City Council declares that, should any provision, section, paragraph, sentence or word of this Resolution be rendered or declared invalid by any final court action in a court of competent jurisdiction or by reason of any preemptive legislation, the remaining provisions, sections, paragraphs, sentences or words of the Resolution as hereby adopted shall remain in full force and effect. Section 5. Effective Date That this Resolution shall take effect upon its adoption. Section 6. Certification That the City Clerk shall certify as to the adoption of this Resolution and shall cause the same to be processed in the manner required by law. Presented by Approved as to form By: Sarah Schoen Jill D.S. Maland Director of Finance/Treasurer Lounsbery Ferguson Altona & Peak Acting City Attorney Page 91 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ATTACHMENT A Open Space District Name 1 El Rancho del Rey Units 1-4 2 Lark Haven 3 Rancho Robinhood Units 1 & 2 4 Bonita Ridge 5 South Bay Villas 6 Hilltop Vista 7 Zenith Units 2, 3, & 4 8 Rancho Robinhood Unit 3 9 El Rancho del Rey 10 El Rancho del Rey 6, Casa Del Rey 11 Hidden Vista Village 14 Bonita Long Canyon 15 Bonita Haciendas 17 Bel Air Ridge 18 Rancho del Sur 20 Zone 1 Desilting Basin 20 Zone 2 Rice Canyon 20 Zone 3 H Street 20 Zone 4 Business Center 20 Zone 5 SPA I 20 Zone 6 SPA II 20 Zone 7 SPA III 20 Zone 8 N Desilting Basin 20 Zone 9 Telegraph Canyon Channel 23 Otay Rio Business Park 24 Canyon View Homes 26 Park Bonita 31 Telegraph Canyon Estates 33 Broadway Business Home Village - Eastlake Maintenance District No. 1 Zone A - Eastlake Maintenance District No. 1 Zone B - Eastlake Maintenance District No. 1 Zone C - Eastlake Maintenance District No. 1 Zone D - Eastlake Maintenance District No. 1 Zone E - Bay Blvd Maintenance District - Town Centre Maintenance District Page 92 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. 2023 - RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING THE ENGINEER’S REPORT, DECLARING THE INTENTION TO LEVY AND COLLECT ASSESSMENTS; AND SETTING A PUBLIC HEARING REGARDING THE FISCAL YEAR 2023-24 ASSESSMENTS FOR OPEN SPACE DISTRICTS 2 THROUGH 10, 14, 15, 17, 18, 20 (ZONES 1 THROUGH 6, 8, AND 9), 23, 24, 26, 31, 33, EASTLAKE MAINTENANCE DISTRICT NO 1, TOWN CENTRE, AND BAY BOULEVARD MAINTENANCE DISTRICT WHEREAS, pursuant to Article 4, Chapter 1, part 2 of Division 15 of the California Streets and Highways Code, also known as “Landscaping and Lighting Act of 1972” and Chula Vista Municipal Code Chapter 17.07, Spicer Consulting Group, LLC, has prepared and filed, on behalf of and under the direction of the City Engineer, the annual report (Engineer’s Report) for all existing Open Space Maintenance Districts in the City of Chula Vista (City); and WHEREAS, the Engineer’s Report is presented to the Council for approval in order to proceed with the public hearing set for July 11, 2023, in accordance with the Landscaping and Lighting Act of 1972. The Report covers Open Space Districts 2 through 10, 14, 15, 17, 18, 20 (Zones 1 through 6, 8, and 9), 23, 24, 26, 31, 33, Eastlake Maintenance District No 1, Town Centre, and Bay Boulevard Maintenance District; and Page 93 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Resolution No. 2023_________ Page 2 WHEREAS, the proposed assessments for Fiscal Year 2023-24 are as follows: Open Space District or Zone Assessment per EDU Collectible per EDU Projected Revenue (5) FY 22-23 Proposed FY 23-24 FY 22-23 Proposed FY 23-24 Variance ($) Variance (%) 2 $67.40 $70.26 $67.40 $70.27 $2.87 4.26% $17,424.48 3 $461.50 $481.16 $461.51 $481.17 $19.66 4.26% $61,107.32 4 $487.44 $508.20 $487.45 $508.21 $20.77 4.26% $105,705.60 5 $475.32 $495.58 $475.34 $495.59 $20.25 4.26% $60,460.76 6 $235.06 $245.08 $235.08 $245.09 $10.01 4.26% $39,702.96 7 $164.18 $171.18 $164.20 $171.19 $6.99 4.26% $17,118.00 8 $750.18 $782.14 $750.18 $782.14 $31.96 4.26% $86,035.40 9 $212.60 $221.64 $212.60 $221.66 $9.06 4.26% $85,331.40 10 $143.46 $149.57 $143.46 $149.57 $6.11 4.26% $98,234.19 14 $466.70 $486.58 $466.70 $486.58 $19.88 4.26% $419,431.96 15 $447.74 $466.82 $447.76 $466.83 $19.07 4.26% $26,608.74 17 $214.32 $223.46 $214.33 $223.46 $9.13 4.26% $10,279.16 18 $430.00 $430.00 $506.46 $528.03 $21.58 4.26% $187,480.00 20 Zone 1 - Desilting basin $78.26 $81.59 $78.26 $81.59 $3.33 4.26% $71,957.76 Zone 2 - Rice Canyon $5.93 $6.18 $5.93 $6.18 $0.25 4.26% $24,461.15 Zone 3 - H Street $8.46 $8.82 $8.46 $8.82 $0.36 4.26% $54,180.06 Zone 4 - Business Center $65.07 $67.85 $65.07 $67.85 $2.77 4.26% $176,384.36 Zone 5 - SPA I $475.60 $495.87 $475.60 $495.87 $20.26 4.26% $890,078.11 Zone 6 - SPA II $365.43 $380.99 $365.43 $380.99 $15.57 4.26% $218,384.87 Zone 8 - N Desilting Basin $51.99 $54.21 $51.99 $54.21 $2.21 4.26% $6,440.85 Zone 9 - Tel Cyn Channel $41.28 $43.04 $41.28 $43.04 $1.76 4.26% $2,152.55 23 $511.33 $533.11 $579.06 $603.73 $24.67 4.26% $61,296.76 24 $867.72 $904.70 $867.74 $904.70 $36.97 4.26% $36,188.00 26 $681.04 $710.04 $681.04 $710.06 $29.01 4.26% $13,490.76 31 $580.00 $580.00 $703.52 $733.49 $29.97 4.26% $199,520.00 33 (1) $0.00 $0.00 $1,719.38 $1,792.62 $73.25 4.26% $0.00 ELMD 1 Otay Lakes Rd (2) Zone A - Eastlake I $16.08 $16.76 $16.08 $16.76 $0.68 4.26% $145,828.45 Zone B - Eastlake Greens $26.34 $27.46 $26.34 $27.46 $1.12 4.26% $92,694.32 Zone C - Oly Training Ctr $3.34 $5.78 $218.13 $227.42 $9.29 4.26% $54,226.00 Zone D - Salt Creek I $290.93 $303.32 $290.93 $303.32 $12.39 4.26% $128,546.40 Zone E - Tel Cyn Chnl $20.00 $20.00 $41.47 $43.24 $1.77 4.26% $13,360.60 Bay Boulevard (3) $1,995.30 $1,995.30 $3,753.27 $3,913.16 $159.89 4.26% $12,749.97 Town Centre (4) $0.00 $0.00 $0.13371 $0.13941 $0.00570 4.26% $0.00 Total Projected Revenues $3,416,860.93 (1) OSD 33 was formed several years ago in anticipation of development. The project has not progressed and consequently there is no maintenance. (2) Zones A - D Share in the cost of Otay Lakes Road medians and off-site parkways. Collectible and projected revenue for Otay Lakes Road are reflected in collectible and projected revenue for Zones A - D. (3) Bay Boulevard rates are based on acres. (4) Town Centre rates have been based on parcel square footage since FY 2001-02. However, a Downtown PBID replaced this District in 2001, but the City determined that there was some potential long-term exposure for the City based on the remote potential that the current PBID might not receive sufficient support for renewal processes. (5) The Projected Revenue are preliminary figures based upon the prior year's EDU assignments and the Proposed Rates for Fiscal Year 2023-24. Page 94 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Resolution No. 2023_________ Page 3 NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it approves this Engineer’s Report for City Open Space Districts 2 through 10, 14, 15, 17, 18, 20 (Zones 1 through 6, 8, and 9), 23, 24, 26, 31, 33, Eastlake Maintenance District No 1, Town Centre, and Bay Boulevard Maintenance District, in the form presented, with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Clerk. BE IT FURTHER RESOLVED, that the City Council of the City of Chula Vista declares its intention to levy and collect the assessments for City Open Space Districts 2 through 10, 14, 15, 17, 18, 20 (Zones 1 through 6, 8, and 9), 23, 24, 26, 31 33, Eastlake Maintenance District No 1, Town Centre, and Bay Boulevard Maintenance District, as identified in the Engineer’s Report, for the Fiscal Year 2023-24. BE IT FURTHER RESOLVED that the City Council sets July 11, 2023, at 5:00 p.m. in the City Council Chambers, City of Chula Vista, 276 Fourth Avenue, Chula Vista, California as the date and time for the public hearing on the assessments. Presented by Approved as to form By: Sarah Schoen Jill D.S. Maland Director of Finance/Treasurer Lounsbery Ferguson Altona & Peak Acting City Attorney Page 95 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. 2023 - RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING THE ENGINEER’S REPORT, DECLARING THE INTENTION TO LEVY AND COLLECT ASSESSMENTS; AND SETTING A PUBLIC HEARING REGARDING THE FISCAL YEAR 2023-24 ASSESSMENTS FOR OPEN SPACE DISTRICT 1 AND OPEN SPACE DISTRICT 20 ZONE 7 WHEREAS, pursuant to Article 4, Chapter 1, part 2 of Division 15 of the California Streets and Highways Code, also known as “Landscaping and Lighting Act of 1972” and Chula Vista Municipal Code Chapter 17.07, Spicer Consulting Group, LLC, has prepared and filed, on behalf of and under the direction of the City Engineer, the annual report (Engineer’s Report) for all existing Open Space Maintenance Districts in the City of Chula Vista (City); and WHEREAS, the Engineer’s Report is presented to the Council for approval in order to proceed with the public hearing set for July 11, 2023, in accordance with the Landscaping and Lighting Act of 1972. The Report covers Open Space District 1 and Open Space District 20 Zone 7; and WHEREAS, the proposed assessments for Fiscal Year 2023-24 are as follows: Open Space District or Zone Assessment per EDU Collectible per EDU Projected Revenue (1) FY 22-23 Proposed FY 23-24 FY 22-23 Proposed FY 23-24 Variance ($) Variance (%) 1 $145.30 $151.49 $145.30 $151.49 $6.19 4.26% $99,256.79 OSD 20 Zone 7 - SPA III $225.56 $235.17 $225.56 $235.17 $9.61 4.26% $274,865.41 Total Projected Revenues $374,122.20 (1) The Projected Revenue are preliminary figures based upon the prior year's EDU assignments and the Proposed Rates for Fiscal Year 2023-24. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it approves this Engineer’s Report for City Open Space District 1 and Open Space District 20 Zone 7, in the form presented, with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Clerk. BE IT FURTHER RESOLVED, that the City Council of the City of Chula Vista declares its intention to levy and collect the assessments for City Open Space District 1 and Open Space District 20 Zone 7, as identified in the Engineer’s Report, for the Fiscal Year 2023-24. BE IT FURTHER RESOLVED that the City Council sets July 11, 2023, at 5:00 p.m. in the City Council Chambers, City of Chula Vista, 276 Fourth Avenue, Chula Vista, California as the date and time for the public hearing on the assessments. Page 96 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Resolution No. 2023- Page 2 Presented by Approved as to form By: Sarah Schoen Jill D.S. Maland Director of Finance/Treasurer Lounsbery Ferguson Altona & Peak Acting City Attorney Page 97 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. 2023 - RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING THE ENGINEER’S REPORT, DECLARING THE INTENTION TO LEVY AND COLLECT ASSESSMENTS; AND SETTING A PUBLIC HEARING REGARDING THE FISCAL YEAR 2023-24 ASSESSMENTS FOR OPEN SPACE DISTRICT 11 WHEREAS, pursuant to Article 4, Chapter 1, part 2 of Division 15 of the California Streets and Highways Code, also known as “Landscaping and Lighting Act of 1972” and Chula Vista Municipal Code Chapter 17.07, Spicer Consulting Group, LLC, has prepared and filed, on behalf of and under the direction of the City Engineer, the annual report (Engineer’s Report) for all existing Open Space Maintenance Districts in the City of Chula Vista (City); and WHEREAS, the Engineer’s Report is presented to the Council for approval in order to proceed with the public hearing set for July 11, 2023, in accordance with the Landscaping and Lighting Act of 1972. The Report covers Open Space District 11; and WHEREAS, the proposed assessments for Fiscal Year 2023-24 are as follows: Open Space District or Zone Assessment per EDU Collectible per EDU Projected Revenue (1) FY 22-23 Proposed FY 23-24 FY 22-23 Proposed FY 23-24 Variance ($) Variance (%) 11 $145.19 $151.37 $145.19 $151.37 $6.19 4.26% $199,971.96 Total Projected Revenues $199,971.96 (1) The Projected Revenue are preliminary figures based upon the prior year's EDU assignments and the Proposed Rates for Fiscal Year 2023-24. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it approves this Engineer’s Report for City Open Space District 11, in the form presented, with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Clerk. BE IT FURTHER RESOLVED, that the City Council of the City of Chula Vista declares its intention to levy and collect the assessments for City Open Space Districts 11, as identified in the Engineer’s Report, for the Fiscal Year 2023-24. BE IT FURTHER RESOLVED that the City Council sets July 11, 2023, at 5:00 p.m. in the City Council Chambers, City of Chula Vista, 276 Fourth Avenue, Chula Vista, California as the date and time for the public hearing on the assessments. Presented by Approved as to form By: Sarah Schoen Jill D.S. Maland Director of Finance/Treasurer Lounsbery Ferguson Altona & Peak Acting City Attorney Page 98 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Table 1. Open Space Districts within the City of Chula Vista OSD #Location 1 East of Paseo Ranchero - H Street & Telegraph Canyon 2 South and East of Loma Verde Park 3 South of Allen School Lane 4 Camino Elevado north of Otay Lakes Road 5 North end of Crest Drive south of E Street 6 Camino Vista Real north of Telegraph Cyn Rd 7 North & South of Palomar, east of I-805 8 Surrey Drive southwest of Otay Lakes Road 9 Paseo del Rey, north of Telegraph Canyon Road 10 West of Paseo Ranchero - H & J Streets 11 East H Street, east of I-805 14 North of East H Street - Otay Lakes Road & Corral 15 Canyon Drive, east of Otay Lakes Road 17 Northeast of Paseo Ladera & East J Street 18 East end of East Naples Street 20 Zone 1 Desilting Basin North of East H St, west of Otay Lakes Road Zone 2 Rice Canyon Zone 3 H Street Zone 4 Business Center Zone 5 SPA I Zone 6 SPA II Zone 7 SPA III Zone 8 N Desilting Basin Zone 9 Telegraph Cyn Channel 23 West of Heritage/Otay Valley Road, south of Otay Rio 24 Rutgers Avenue, south of East H Street 26 West of the intersection of E St & Bonita Road 31 North of Otay Lakes Road, west of SR-125 33 West side of Broadway - J & K Streets ELMD Zone A Eastlake I Eastlake Maintenance District No. 1 (ELMD) Zone B Eastlake Greens Zone C Olympic Training Center Zone D Salt Creek I Zone E Telegraph Cyn Channel - Bay Boulevard - E & F Streets - Third Avenue - E & G Streets Canyon View Homes Park Bonita Telegraph Canyon Estates Broadway Business Home Village Bay Boulevard Maintenance District Town Centre Maintenance District Hidden Vista Village Bonita Long Canyon Bonita Haciendas Bel Air Ridge Rancho del Sur Otay Rio Business Park South Bay Villas Hilltop Vista Zenith Units 2, 3, and 4 Rancho Robinhood Unit 3 El Rancho del Rey El Rancho del Rey 6, Casa del Rey Name El Rancho del Rey Units 1 - 4 Lark Haven Rancho Robinhood Units 1 & 2 Bonita Ridge Page 99 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda FY 22-23 Proposed FY 23-24 FY 22-23 Proposed FY 23-24 Variance ($) Variance (%) 1 $145.30 $151.49 $145.30 $151.49 $6.19 4.26% $99,256.79 2 $67.40 $70.26 $67.40 $70.27 $2.87 4.26% $17,424.48 3 $461.50 $481.16 $461.51 $481.17 $19.66 4.26% $61,107.32 4 $487.44 $508.20 $487.45 $508.21 $20.77 4.26% $105,705.60 5 $475.32 $495.58 $475.34 $495.59 $20.25 4.26% $60,460.76 6 $235.06 $245.08 $235.08 $245.09 $10.01 4.26% $39,702.96 7 $164.18 $171.18 $164.20 $171.19 $6.99 4.26% $17,118.00 8 $750.18 $782.14 $750.18 $782.14 $31.96 4.26% $86,035.40 9 $212.60 $221.64 $212.60 $221.66 $9.06 4.26% $85,331.40 10 $143.46 $149.57 $143.46 $149.57 $6.11 4.26% $98,234.19 11 $145.19 $151.37 $145.19 $151.37 $6.19 4.26% $199,971.96 14 $466.70 $486.58 $466.70 $486.58 $19.88 4.26% $419,431.96 15 $447.74 $466.82 $447.76 $466.83 $19.07 4.26% $26,608.74 17 $214.32 $223.46 $214.33 $223.46 $9.13 4.26% $10,279.16 18 $430.00 $430.00 $506.46 $528.03 $21.58 4.26% $187,480.00 20 Zone 1 - Desilting Basin $78.26 $81.59 $78.26 $81.59 $3.33 4.26% $71,957.76 Zone 2 - Rice Canyon $5.93 $6.18 $5.93 $6.18 $0.25 4.26% $24,461.15 Zone 3 - H Street $8.46 $8.82 $8.46 $8.82 $0.36 4.26% $54,180.06 Zone 4 - Business Center $65.07 $67.85 $65.07 $67.85 $2.77 4.26% $176,384.36 Zone 5 - SPA I $475.60 $495.87 $475.60 $495.87 $20.26 4.26% $890,078.11 Zone 6 - SPA II $365.43 $380.99 $365.43 $380.99 $15.57 4.26% $218,384.87 Zone 7 - SPA III $225.56 $235.17 $225.56 $235.17 $9.61 4.26% $274,865.41 Zone 8 - N Desilting Basin $51.99 $54.21 $51.99 $54.21 $2.21 4.26% $6,440.85 Zone 9 - Tel Cyn Channel $41.28 $43.04 $41.28 $43.04 $1.76 4.26% $2,152.55 23 $511.33 $533.11 $579.06 $603.73 $24.67 4.26% $61,296.76 24 $867.72 $904.70 $867.74 $904.70 $36.97 4.26% $36,188.00 26 $681.04 $710.04 $681.04 $710.06 $29.01 4.26% $13,490.76 31 $580.00 $580.00 $703.52 $733.49 $29.97 4.26% $199,520.00 33 (1)$0.00 $0.00 $1,719.38 $1,792.62 $73.25 4.26% $0.00 ELMD No. 1 Otay Lakes Rd (2)$0.00 $0.00 $2.50 $2.50 $0.00 0.00% $0.00 Zone A - Eastlake I $16.08 $16.76 $16.08 $16.76 $0.68 4.26% $145,828.45 Zone B - Eastlake Greens $26.34 $27.46 $26.34 $27.46 $1.12 4.26% $92,694.32 Zone C - Oly Training Ctr $3.34 $5.78 $218.13 $227.42 $9.29 4.26% $54,226.00 Zone D - Salt Creek I $290.93 $303.32 $290.93 $303.32 $12.39 4.26% $128,546.40 Zone E - Tel Cyn Chnl (3)$20.00 $20.00 $41.47 $43.24 $1.77 4.26% $13,360.60 Bay Boulevard (4)$1,995.30 $1,995.30 $3,753.27 $3,913.16 $159.89 4.26% $12,749.97 Town Centre (5)$0.00 $0.00 $0.13371 $0.13941 $0.00570 4.26% $0.00 Total Projected Revenues $3,990,955.09 (3) Portions of Eastlake I and Eastlake Greens are in this Benefit area. (4) Bay boulevard rates are based on acres. Open Space District or Zone Collectible per Unit ($) Projected Revenue (6) Maximum Assessment per Unit ($) (1) OSD 33 was formed several years ago in anticipation of development. The project has not progressed and consequently there is no maintenance required. Should the project develop in the future the District may be assessed to cover future maintenance expenses. (2) Zones A - D share in the cost of Otay Lakes Road medians and off-site parkways. Collectible and projected revenue for Otay Lakes Road are reflected in collectible and projected revenue for Zones A - D. (5) Town Centre rates have been based on parcel square footage since FY 2001-02. However, a Downtown PBID replaced this District in 2001, but the City determined that there was some potential long-term exposure for the City based on the remote potential that the current PBID might not receive sufficient support for renewal processes. (6) The Projected Revenue are preliminary figures based upon the prior year's EDU assignments and the Proposed Rates for Fiscal Year 2023-24. Page 100 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CITY OF CHULA VISTA Annual Open Space Districts ),6&$/<($5 35(/,0,1$5<(1*,1((565(3257 Page 101 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Table of Contents City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Sections i. Executive Summary i ii. Introduction iii 1. OSD No. 1 (El Rancho Del Rey Units 1 - 4) 1 2. OSD No. 2 (Lark Haven) 2 3. OSD No. 3 (Rancho Robinhood Units 1 - 2) 3 4. OSD No. 4 (Bonita Ridge) 4 5. OSD No. 5 (Southbay Villas) 5 6. OSD No. 6 (Hilltop Vista) 6 7. OSD No. 7 (Zenith Units 2 - 4) 7 8. OSD No. 8 (Rancho Robinhood Unit 3) 8 9. OSD No. 9 (El Rancho Del Rey) 9 10. OSD No. 10 (El Rancho Del Rey 6 & Casa Del Rey) 10 11. OSD No. 11 (Hidden Vista Village) 11 12. OSD No. 14 (Bonita Long Canyon) 12 13. OSD No. 15 (Bonita Haciendas) 13 14. OSD No. 17 (Bel Air Ridge) 14 15. OSD No. 18 (Rancho Del Sur) 15 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) 17 17. OSD No. 23 (Otay Rio Business Park) 24 18. OSD No. 24 (Canyon View Homes) 26 19. OSD No. 26 (Park Bonita) 27 20. OSD No. 31 (Telegraph Canyon Estates) 28 21. OSD No. 33 (Broadway Business Home Village) 29 22. Eastlake Maintenance District No. 1 (Zones A - E) 31 23. Bay Boulevard Maintenance District 36 24. Town Centre Maintenance District 38 25. Assessment Diagrams 40 26. Engineer’s Signature 41 Page 102 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Table of Contents City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Appendices Appendix A – Assessment Diagrams Appendix B – Definitions of Budgeted Items Appendix C – District Cost Summary Appendix D – Assessment Rolls Page 103 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda i. Executive Summary Page | i City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 AGENCY: CITY OF CHULA VISTA PROJECT: OPEN SPACE MAINTENANCE DISTRICTS ENGINEER’S REPORT TO: CITY COUNCIL CITY OF CHULA VISTA STATE OF CALIFORNIA WHEREAS, the City Council (the "City Council") of the City of Chula Vista (the “City”), pursuant to State of California Law, Part 2 of Division 15 of the Streets and Highways Code, the Landscaping and Lighting Act of 1972 (the “1972 Act”), and City of Chula Vista Municipal Code (collectively referred to hereafter as the "Acts"), previously formed each Open Space District ("OSD") referenced herein; WHEREAS, the City Council directed staff to prepare and file a report for Fiscal Year 2023-24 presenting, for each OSD, the plans and specifications for the improvements, an estimate of the costs of the improvements, an assessment diagram and an assessment of the estimated costs to maintain, operate and service the improvements; WHEREAS, the assessments for Fiscal Year 2023-24 have been levied in accordance with the assessment methodology as confirmed by the City Council upon the formation of each OSD and are proportional to the special benefit received by each parcel. The amount assessed to each parcel is equal to or less than the maximum assessment approved at the time of formation plus any allowable increases as described herein; NOW THEREFORE, the following Fiscal Year 2023-24 assessments are made to finance the costs to maintain, operate and service the improvements within each OSD: Open Space District Name Collectible per Unit ($) Maximum Assessment per Unit ($) 1 El Rancho del Rey Units 1-4 $151.49 $151.49 2 Lark haven $70.26 $70.27 3 Rancho Robinhood Units 1 & 2 $481.16 $481.17 4 Bonita Ridge $508.20 $508.21 5 Southbay Villas $495.58 $495.59 6 Hilltop Vista $245.08 $245.09 7 Zenith Units 2, 3, & 4 $171.18 $171.19 8 Rancho Robinhood Unit 3 $782.14 $782.14 9 El Rancho del Rey $221.64 $221.66 10 El Rancho del Rey 6, Casa Del Rey $149.57 $149.57 11 Hidden Vista Village $151.37 $151.37 14 Bonita Long Canyon $486.58 $486.58 15 Bonita Haciendas $466.82 $466.83 17 Bel Air Ridge $223.46 $223.46 18 Rancho del Sur $430.00 $528.03 20 Zone 1 Desilting Basin $81.59 $81.59 20 Zone 2 Rice Canyon $6.18 $6.18 20 Zone 3 H Street $8.82 $8.82 20 Zone 4 Business Center $67.85 $67.85 Page 104 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda i. Executive Summary Page | ii City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District Name Collectible per Unit ($) Maximum Assessment per Unit ($) 20 Zone 5 SPA I $495.87 $495.87 20 Zone 6 SPA II $380.99 $380.99 20 Zone 7 SPA III $235.17 $235.17 20 Zone 8 N Desilting Basin $54.21 $54.21 20 Zone 9 Telegraph Canyon Channel $43.04 $43.04 23 Otay Rio Business Park $533.11 $603.73 24 Canyon View Homes $904.70 $904.70 26 Park Bonita $710.04 $710.06 31 Telegraph Canyon Estates $580.00 $733.49 33 Broadway Business Home Village $0.00 $1,792.62 - Eastlake Maintenance District No. 1 Zone A $16.76 $16.76 - Eastlake Maintenance District No. 1 Zone B $27.46 $27.46 - Eastlake Maintenance District No. 1 Zone C $5.78 $227.42 - Eastlake Maintenance District No. 1 Zone D $303.32 $303.32 - Eastlake Maintenance District No. 1 Zone E $20.00 $43.24 - Bay Blvd Maintenance District $1,995.30 $3,913.16 - Town CentUH Maintenance District $0.00 $0.13941 Page 105 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ii. Introduction Page | iii City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The City administers and maintains 36 Open Space Districts and associated zones that have been established over the last 40 years. The OSDs provide a financing mechanism to maintain the public open space areas associated with each particular development, ensuring the continued maintenance, operations, servicing, and administration of various improvements located within the public right- of- way and dedicated easements; all within the boundaries of each OSD. This report has been prepared to support the annual assessment of the OSDs within the City's boundaries. The following information is presented to provide general information about the OSDs. Additional details specific to each OSD are listed in each OSD's dedicated section of this Engineer’s Report. Proposition 218 In November 1996, California voters approved Proposition 218. The provisions of the Proposition are now contained in the California Constitution Articles XIIIC and XIIID. All assessments described in the report and approved by the City Council are prepared in accordance with the 1972 Act, the City's Municipal Code, and are in compliance with the provision of the California Constitution Article XIIID. Pursuant to California Constitution Article XIIID Section 5, certain existing assessments are exempt from the substantive and procedural requirements of the Article XIIID Section 4 and the property owner balloting for the assessments is not required until such time that the assessments are increased or assessment methods changed. Therefore, any pre-existing assessment amount (and any assessment identified in the Report) for those districts is subsequently exempt from the procedural requirements of Article XIIID Section 4. However, any future assessment increases in excess of that will be subject to the new requirements identified in California Constitution Article XIIID. Plans and Specifications The boundaries for each OSD can be located in Appendix A. The specific plans and specifications related to the continued maintenance, operations, servicing, and administration of the various improvements, is detailed in each OSD's dedicated section of this report. Cost Summaries The summary of the costs for each OSD can be located in Appendix C of this report. The summary includes the Fiscal Year 2023-24 Budget, the projected number of units for each OSD, and the Fiscal Year 2023-24 Collectible per unit for each OSD. Annual Inflation Factor Pursuant to the City's Municipal Code, annually the maximum assessment amount is subject to an inflation factor. The maximum assessment shall be the prior year's assessment increased or decreased by the inflation factor. The City's Municipal Code defines the inflation factor as the lesser of (1) the January to January San Diego Metropolitan Area All Urban Consumer Price Index (CPI) or (2) the change in the estimated California Fourth Quarter Per Capita Personal Income as contained in the Governor's budget published in January. The maximum assessments for Fiscal Year 2023-24 are proposed at the Fiscal Year 2022-23 amounts adjusted by the inflation factor defined in the City's Municipal Code. The inflation factor for the Fiscal Year 2023-24 equals 4.26%, which is the change in the estimated California Fourth Quarter Per Capita Personal Income. Page 106 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ii. Introduction Page | iv City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Method of Apportionment Statutory Considerations Pursuant to the Acts and Article XIIID, all parcels that receive a special benefit conferred upon them as a result of the maintenance and operation of improvements and services shall be identified, and the proportionate special benefit derived by each identified parcel shall be determined in relationship to the entire costs of the maintenance and operation of improvements. The Acts permit the establishment of assessment districts by local agencies for the purpose of providing certain public improvements which include the operation, maintenance and servicing of landscaping improvements. The Acts and more specifically, the 1972 Act requires that maintenance assessments must be levied according to benefit rather than according to assessed value. This Section states: "The net amount to be assessed upon lands within an assessment district may be apportioned by any formula or method which fairly distributes the net amount among all assessable lots or parcels in proportion to the estimated benefit to be received by each such lot or parcel from the improvements." The 1972 Act also permits the designation of zones of benefit within any individual assessment district if "by reasons or variations in the nature, location, and extent of the improvements, the various areas will receive different degrees of benefit from the improvement" (Sec. 22574). Article XIIID, Section 4(a) of the California Constitution limits the amount of any assessment to the proportional special benefit conferred on the property. Article XIIID also provides that publicly owned properties must be assessed unless there is clear and convincing evidence that those properties receive no special benefit from the assessment. Examples of parcels exempted from the assessment would be the areas of public streets, public avenues, public lanes, public roads, public drives, public courts, public alleys, public easements and rights-of-ways, public greenbelts and public parkways. Special Benefit Pursuant to Proposition 218, or more specifically Section 2(i) of Article XIIID "Special benefit means a particular and distinct benefit over and above general benefits conferred on real property located in the district or to the public at large. General enhancement of property value does not constitute special benefit." All parcels that have special benefit conferred upon them as a result of the improvements and services provided shall be identified, and the proportionate special benefit derived by each identified parcel shall be determined in relationship to the entire cost of the services and activities. Basis of Assessment The basis of assessment and method or apportionment for each OSD is provided within each OSD's section of this Engineer’s Report. Page 107 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 1. OSD No. 1 (El Rancho Del Rey Units 1 – 4) Page | 1 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 1 (OSD No. 1) was formed on August 7, 1973 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries Open Space District No. 1 is generally located between East H Street to the north, Otay Lakes Road to the east, Telegraph Canyon Road to the South, and Paseo Ranchero to the west. A copy of the boundary map for OSD No. 1 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 1 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement i Trail maintenance Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 1 is 655.20. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $99,256.79 EDU 655.20 Fiscal Year 2023-24 Collectible per EDU $151.49 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $151.49 per EDU. Page 108 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2. OSD No. 2 (Lark Haven) Page | 2 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 2 (OSD No. 2) was formed on October 2, 1973 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 2 is generally located South and East of Loma Verde Park and north and south of East Orange Avenue. A copy of the boundary map for OSD No. 2 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 2 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 2 is 248.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $17,424.48 EDU 248.00 Fiscal Year 2023-24 Collectible per EDU $70.26 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $70.27 per EDU. Page 109 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 3. OSD No. 3 (Rancho Robinhood Units 1 - 2) Page | 3 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 3 (OSD No. 3) was formed on November 30, 1973 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 3 is generally located within the boundary of the Rancho Robinhood 1 and 2 Subdivision. A copy of the boundary map for OSD No. 3 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 3 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 3 is 127.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $61,107.32 EDU 127.00 Fiscal Year 2023-24 Collectible per EDU $481.16 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $481.17 per EDU. Page 110 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 4. OSD No. 4 (Bonita Ridge) Page | 4 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 4 (OSD No. 4) was formed on August 6, 1974 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 4 is generally located on Camino Elevado north of Otay Lakes Rd and south of Acacia Avenue. A copy of the boundary map for OSD No. 4 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 4 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 4 is 208.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $105,705.60 EDU 208.00 Fiscal Year 2023-24 Collectible per EDU $508.20 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $508.21 per EDU. Page 111 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 5. OSD No. 5 (Southbay Villas) Page | 5 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 5 (OSD No. 5) was formed on August 5, 1975 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 5 is generally located at the north end of Crest Drive and south of East J Street. A copy of the boundary map for OSD No. 5 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 5 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 5 is 122.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $60,460.76 EDU 122.00 Fiscal Year 2023-24 Collectible per EDU $495.58 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $495.59 per EDU. Page 112 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6. OSD No. 6 (Hilltop Vista) Page | 6 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 6 (OSD No. 6) was formed on December 23, 1975 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 6 is generally located on Camino Vista Real and Camino Entrada, north of Telegraph Canyon Road, and east of Nacion Avenue. A copy of the boundary map for OSD No. 6 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 6 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 6 is 162.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $39,702.96 EDU 162.00 Fiscal Year 2023-24 Collectible per EDU $245.08 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $245.09 per EDU. Page 113 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 7. OSD No. 7 (Zenith Units 2 - 4) Page | 7 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 7 (OSD No. 7) was formed on October 12, 1976 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 7 is generally located north and south of East Palomar, east of I-805 and west of Oleander Avenue. A copy of the boundary map for OSD No. 7 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 7 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 7 is 100.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $17,118.00 EDU 100.00 Fiscal Year 2023-24 Collectible per EDU $171.18 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $171.19 per EDU. Page 114 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 8. OSD No. 8 (Rancho Robinhood Unit 3) Page | 8 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 8 (OSD No. 8) was formed on June 14, 1977 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 8 is generally located at Surrey Drive southwest of Otay Lakes Road. A copy of the boundary map for OSD No. 8 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 8 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 8 is 110.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $86,035.40 EDU 110.00 Fiscal Year 2023-24 Collectible per EDU $782.14 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $782.14 per EDU. Page 115 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 9. OSD No. 9 (El Rancho Del Rey) Page | 9 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 9 (OSD No. 9) was formed on October 25, 1977 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 9 is generally located at Paseo Del Rey, north of Telegraph Canyon Road and south of East J Street. A copy of the boundary map for OSD No. 9 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 9 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 9 is 385.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $85,331.40 EDU 385.00 Fiscal Year 2023-24 Collectible per EDU $221.64 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $221.66 per EDU. Page 116 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 10. OSD No. 10 (El Rancho Del Rey 6 & Casa Del Rey) Page | 10 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 10 (OSD No. 10) was formed on January 23, 1979 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 10 is generally located along East J Street, west of Paseo Ranchero Road, north of Telegraph Canyon Road, and south of East H Street. A copy of the boundary map for OSD No. 10 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 10 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 10 is 656.76. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $98,234.19 EDU 656.76 Fiscal Year 2023-24 Collectible per EDU $149.57 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $149.57 per EDU. Page 117 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 11. OSD No. 11 (Hidden Vista Village) Page | 11 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 11 (OSD No. 11) was formed on December 13, 1983 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 11 is generally located along East H Street and Hidden Valley Drive, and east of I-805. A copy of the boundary map for OSD No. 11 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 11 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon land use type. Single family homes and condominiums will receive 1.00 EDU per unit, apartment properties will receive 0.50 EDU per unit, and commercial property will receive 8.5333 EDU per acre. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 11 is 1,321.04. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $199,971.96 EDU 1,321.04 Fiscal Year 2023-24 Collectible per EDU $151.37 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $151.37 per EDU. Page 118 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 12. OSD No. 14 (Bonita Long Canyon) Page | 12 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 14 (OSD No. 14) was formed on January 14, 1986 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 14 is generally located north of East H Street, north east of Otay Lakes Road, and along and south of Corral Canyon Road. A copy of the boundary map for OSD No. 14 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 14 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 14 is 862.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $419,431.96 EDU 862.00 Fiscal Year 2023-24 Collectible per EDU $486.58 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $486.58 per EDU. Page 119 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 13. OSD No. 15 (Bonita Haciendas) Page | 13 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 15 (OSD No. 15) was formed on October 14, 1986 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 15 is generally located at Canyon Drive and Via Hacienda Road, east of Otay Lakes Road. A copy of the boundary map for OSD No. 15 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 15 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 15 is 57.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $26,608.74 EDU 57.00 Fiscal Year 2023-24 Collectible per EDU $466.82 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $466.83 per EDU. Page 120 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 14. OSD No. 17 (Bel Air Ridge) Page | 14 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 17 (OSD No. 17) was formed on December 15, 1987 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 17 is generally located north of East J Street and west of Dorado Way. A copy of the boundary map for OSD No. 17 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 17 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement i Erosion Repair Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 17 is 46.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $10,279.16 EDU 46.00 Fiscal Year 2023-24 Collectible per EDU $223.46 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $223.46 per EDU. Page 121 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 15. OSD No. 18 (Rancho Del Sur) Page | 15 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 18 (OSD No. 18) was formed on August 9, 1988 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 18 is generally located at the east end of Naples Street, both east and west of the north end of Medical Center Drive, and south of Telegraph Canyon Road. A copy of the boundary map for OSD No. 18 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 18 under these proceedings is described as follows, but shall not be limited to: i Irrigation i Fertilization i Removal of weeds, trash and litter i Pruning of trees and shrubs i Replacement of dead or diseased trees and shrubs i Repair of equipment and facilities i Weed abatement i Erosion repair i Maintenance and ornamental light costs for entry monumentation and decorative sidewalks at the intersections of Medical Center Drive with Telegraph Canyon Road and East Naples Street. i Stucco "Community Theme" walls Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon land use type. Single family homes will receive 1.00 EDU per unit and condos and apartment properties will receive 0.50 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 18 is 436.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $187,480.00 EDU 436.00 Fiscal Year 2023-24 Collectible per EDU $430.00 Page 122 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 15. OSD No. 18 (Rancho Del Sur) Page | 16 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $528.03 per EDU. Page 123 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 17 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 20 (OSD No. 20) was formed on December 5, 1989 to fund the maintenance of various improvements and services within the boundaries of the district. The district originally consisted of seven zones, Zones 1 - 7. Furthermore, Zone 8 was formed on July 26, 1994 and Zone 9 was formed on July 11, 1995. Description of District Boundaries The OSD No. 20, Zones 1 through 9 are generally located along of East “H” Street, north of Telegraph Canyon Road and west of Otay Lakes Road. A copy of the boundary map for OSD No. 20 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 20, Zones 1-9 under these proceedings is described as follows, but shall not be limited to: i Drainage systems i Maintenance of drop structures i Irrigation systems i Landscape maintenance i Wall maintenance i Maintain, repair, and replacement of the desilting basins i Maintain, repair, and replacement of the access road i Maintenance of the drainage channel Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. The Fiscal Year 2023-24 assessment for each Zone and the associated assessment methodology is detailed as follows: Page 124 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 18 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Zone 1 To apportion the total estimated costs of OSD No. 20 - Zone 1 during any fiscal year, each of the parcels within the boundaries of Zone 1 are assigned Equivalent Dwelling Units (EDU) based upon land use type, density, and runoff coefficients. Land Use and EDU Assignments Land Use Runoff Density Runoff Coefficient EDU Single Family Detached 0-2 0.60 1.00 2-4 0.60 0.33 4-6 0.60 0.20 6-8 0.60 0.14 8-10 0.60 0.11 Single Family Attached 10-12 0.70 0.10 12-20 0.70 0.07 Multi-Family 20+ 0.80 0.05 Employment Park 0.90 1.50/acre Commercial 0.80 1.33/acre Church/School 0.70 1.17/acre Daycare 0.70 1.17/acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The current sum of the EDUs within OSD No. 20 - Zone 1 is 881.95. The Fiscal Year 2023-24 assessment for Zone 1 is spread as follows: Total Fiscal Year 2023-24 Budget $71,957.76 EDU 881.95 Fiscal Year 2023-24 Collectible per EDU $81.59 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $81.59 per EDU. Zone 2 To apportion the total estimated costs of OSD No. 20 - Zone 2 during any fiscal year, each of the parcels within the boundaries of Zone 2 are assigned Equivalent Dwelling Units (EDU) based upon land use type and population factors. Recreation Population Factor Land Use Population EDU Residential 2.67/EDU 1.00 Commercial 15/EDU 5.62 Business Park 40/acre 14.99 The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has undertaken the appropriate Proposition 218 proceedings. The current sum of the EDUs within OSD No. 20 - Zone 2 is 3,957.82. Page 125 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 19 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The Fiscal Year 2023-24 assessment for Zone 2 is spread as follows: Total Fiscal Year 2023-24 Budget $24,461.15 EDU 3,957.82 Fiscal Year 2023-24 Collectible per EDU $6.18 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $6.18 per EDU. Zone 3 To apportion the total estimated costs of OSD No. 20 - Zone 3 during any fiscal year, each of the parcels within the boundaries of Zone 3 are assigned Equivalent Dwelling Units (EDU) based upon land use type and average daily traffic (ADT) generation factors. ADT Factor Land Use Density EDU Single Family Detached 0-10 1.00 Single Family Attached 10-20 0.80 Multi-Family 20+ 0.60 Employment Park 30.00 per acre Commercial 40.00 per acre Church 1.00 per acre Daycare 1.00 per acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 3 is 6,144.79. The Fiscal Year 2023-24 assessment for Zone 3 is spread as follows: Total Fiscal Year 2023-24 Budget $54,180.06 EDU 6,144.53 Fiscal Year 2023-24 Collectible per EDU $8.82 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $8.82 per EDU. Zone 4 To apportion the total estimated costs of OSD No. 20 - Zone 4 during any fiscal year, each of the parcels within the boundaries of Zone 4 are assigned Equivalent Dwelling Units (EDU) based upon land use type and average daily traffic (ADT) generation factors. ADT Factor Land Use Density EDU Single Family Detached 0-10 1.00 Single Family Attached 10-20 0.80 Multi-Family 20+ 0.60 Employment Park 30.00 per acre Commercial 40.00 per acre Church 1.00 per acre Daycare 1.00 per acre Page 126 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 20 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 4 is 2,599.79. The Fiscal Year 2023-24 assessment for Zone 4 is spread as follows: Total Fiscal Year 2023-24 Budget $176,384.36 EDU 2,599.79 Fiscal Year 2023-24 Collectible per EDU $67.85 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $67.85 per EDU. Zone 5 To apportion the total estimated costs of OSD No. 20 - Zone 5 during any fiscal year, each of the parcels within the boundaries of Zone 5 are assigned Equivalent Dwelling Units (EDU) based upon land use type and average daily traffic (ADT) generation factors. ADT Factor Land Use Density EDU Single Family Detached 0-10 1.00 Single Family Attached 10-20 0.80 Multi-Family 20+ 0.60 Employment Park 30.00 per acre Commercial 40.00 per acre Church 1.00 per acre Daycare 1.00 per acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 5 is 1,795.00. The Fiscal Year 2023-24 assessment for Zone 5 is spread as follows: Total Fiscal Year 2023-24 Budget $890,078.11 EDU 1,795.00 Fiscal Year 2023-24 Collectible per EDU $495.87 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $495.87 per EDU. Page 127 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 21 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Zone 6 To apportion the total estimated costs of OSD No. 20 - Zone 6 during any fiscal year, each of the parcels within the boundaries of Zone 6 are assigned Equivalent Dwelling Units (EDU) based upon land use type and average daily traffic (ADT) generation factors. ADT Factor Land Use Density EDU Single Family Detached 0-10 1.00 Single Family Attached 10-20 0.80 Multi-Family 20+ 0.60 Employment Park 30.00 per acre Commercial 40.00 per acre Church 1.00 per acre Daycare 1.00 per acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 6 is 573.20. The Fiscal Year 2023-24 assessment for Zone 6 is spread as follows: Total Fiscal Year 2023-24 Budget $218,384.87 EDU 573.20 Fiscal Year 2023-24 Collectible per EDU $380.99 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $380.99 per EDU. Zone 7 To apportion the total estimated costs of OSD No. 20 - Zone 7 during any fiscal year, each of the parcels within the boundaries of Zone 7 are assigned Equivalent Dwelling Units (EDU) based upon land use type and average daily traffic (ADT) generation factors. ADT Factor Land Use Density EDU Single Family Detached 0-10 1.00 Single Family Attached 10-20 0.80 Multi-Family 20+ 0.60 Employment Park 30.00 per acre Commercial 40.00 per acre Church 1.00 per acre Daycare 1.00 pre acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 7 is 1,168.79. Page 128 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 22 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The Fiscal Year 2023-24 assessment for Zone 7 is spread as follows: Total Fiscal Year 2023-24 Budget $274,865.41 EDU 1,168.79 Fiscal Year 2023-24 Collectible per EDU $235.17 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $235.17 per EDU. Zone 8 To apportion the total estimated costs of OSD No. 20 - Zone 8 during any fiscal year, each of the parcels within the boundaries of Zone 8 are assigned Equivalent Dwelling Units (EDU) based upon land use type, density, and runoff coefficients. Land Use and EDU Assignments Land Use Runoff Density Coefficient EDU Single Family Detached 0-2 0.60 1.00 2-4 0.60 0.33 4-6 0.60 0.20 6-8 0.60 0.14 8-10 0.60 0.11 Single Family Attached 10-12 0.70 0.10 12-20 0.70 0.07 Multi-Family 20+ 0.80 0.05 Employment Park 0.90 1.50/acre Commercial 0.80 1.33/acre Church/School 0.70 1.17/acre Daycare 0.70 1.17/acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 8 is 118.82. The Fiscal Year 2023-24 assessment for Zone 8 is spread as follows: Total Fiscal Year 2023-24 Budget $6,440.85 EDU 118.82 Fiscal Year 2023-24 Collectible per EDU $54.21 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $54.21 per EDU. Page 129 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16. OSD No. 20 (Rancho Del Rey, Zones 1 - 9) Page | 23 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Zone 9 To apportion the total estimated costs of OSD No. 20 - Zone 9 during any fiscal year, each of the parcels within the boundaries of Zone 9 are assigned Equivalent Dwelling Units (EDU) based upon land use type, density, and runoff coefficients. Land Use and EDU Assignments Land Use Runoff Density Coefficient EDU Single Family Detached 0-2 0.60 1.00 2-4 0.60 0.33 4-6 0.60 0.20 6-8 0.60 0.14 8-10 0.60 0.11 Single Family Attached 10-12 0.70 0.10 12-20 0.70 0.07 Multi-Family 20+ 0.80 0.05 Employment Park 0.90 1.50/acre Commercial 0.80 1.33/acre Church/School 0.70 1.17/acre Daycare 0.70 1.17/acre The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 20 - Zone 9 is 50.01. The Fiscal Year 2023-24 assessment for Zone 9 is spread as follows: Total Fiscal Year 2023-24 Budget $2,152.55 EDU 50.01 Fiscal Year 2023-24 Collectible per EDU $43.04 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $43.04 per EDU. Page 130 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 17. OSD No. 23 (Otay Rio Business Park) Page | 24 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 23 (OSD No. 23) was formed on September 15, 1992 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 23 is generally located south of Main Street, and west of Heritage Road. A copy of the boundary map for OSD No. 23 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 23 under these proceedings is described as follows, but shall not be limited to: i Maintain landscaping and irrigation system improvements within the designated open space lots, medians and within the parkways adjacent to open space lots i Maintain theme walls and entry monuments located within open space areas including graffiti removal i Maintain brow ditches i Repair, removal, or replacement of all or any part to any improvement i Irrigation, fertilization, trimming, and replacement of dead or diseased landscaping i Weed abatement i Removal of trimmings, trash and litter i Removal of debris from brow ditches Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the estimated traffic generated by the parcel. A standard established within San Diego County is the average daily traffic (ADT) published by the San Diego Association of Governments (SANDAG). An ADT factor has been assigned to each land use type and these factors are used to estimate the traffic generated by each parcel. OSD No. 23 only contains industrial parcels which have the same SANDAG generation factor (200 trips per acre of land). Therefor e, the total ADT for each parcel will be directly proportional to the gross area of the parcel. For purposes of distributing the assessment, each gross acre of land is equivalent to one EDU. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 23 is 114.98. Page 131 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 17. OSD No. 23 (Otay Rio Business Park) Page | 25 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $61,296.76 EDU 114.98 Fiscal Year 2023-24 Collectible per EDU $533.11 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $603.73 per EDU. Page 132 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 18. OSD No. 24 (Canyon View Homes) Page | 26 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 24 (OSD No. 24) was formed on July 21, 1992 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 24 is generally located along Rutgers Avenue, south of East H Street. A copy of the boundary map for OSD No. 24 can be located in Appendix Ad of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 24 under these proceedings is described as follows, but shall not be limited to: i Maintain landscaping and irrigation system improvements within the designated open space lots i Maintain stucco walls located within the open space lots i Maintain drainage facilities within the open space lots i Repair, removal, or replacement of all or any part to any improvement i Irrigation, fertilization, trimming, and replacement of dead or diseased landscaping. i Weed abatement i Removal of trimmings, trash and litter Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 24 is 40.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $36,188.00 EDU 40.00 Fiscal Year 2023-24 Collectible per EDU $904.70 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $904.70 per EDU. Page 133 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 19. OSD No. 26 (Park Bonita) Page | 27 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 26 (OSD No. 26) was formed on August 18, 1992 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 26 is generally located north of Bonita Road, east of Hilltop Drive, and southwest of E Street. A copy of the boundary map for OSD No. 26 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 26 under these proceedings is described as follows, but shall not be limited to: i Maintain landscaping and irrigation system improvements within the designated open space lots and within the parkways along Bonita Road and E Street adjacent to the open space lots i Maintain the theme walls located within the open space lots i Maintain the brow ditch adjacent to the westerly boundary from "E" Street to the existing curb and gutter i Repair, removal, or replacement of all or any part to any improvement i Irrigation, fertilization, trimming, and replacement of dead or diseased landscaping. i Weed abatement i Removal of trimmings, trash and litter Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 26 is 19.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $13,490.76 EDU 19.00 Fiscal Year 2023-24 Collectible per EDU $710.04 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $710.06 per EDU. Page 134 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 20. OSD No. 31 (Telegraph Canyon Estates) Page | 28 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 31 (OSD No. 31) was formed on March 15, 1994 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 31 is generally located north of Otay Lakes Road and west of SR-125. A copy of the boundary map for OSD No. 31 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 31 under these proceedings is described as follows, but shall not be limited to: i Repair, removal, or replacement of all or any part to any improvement i Landscaping, including cultivation, irrigation, trimming, spraying, fertilizing, or treating for disease or injury i Grading activities and the removal of trimmings, rubbish, debris, and other solid waste. i The installation or construction of planting or landscaping, supplemental facilities, public lighting facilities, curbs, gutters, walls, sidewalks, paving, water, drainage, and electrical facilities i The installation of view, sound, wrought iron and decorative walls, and pedestrian fences and retaining walls i Installation of pedestrian walks Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 31 is 344.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $199,520.00 EDU 344.00 Fiscal Year 2023-24 Collectible per EDU $580.00 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $733.49 per EDU. Page 135 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 21. OSD No. 33 (Broadway Business Home Village) Page | 29 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Open Space District No. 33 (OSD No. 33) was formed on November 21, 1995 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The OSD No. 33 is generally located on the West side of Broadway between J Street to the north and K Street to the south. A copy of the boundary map for OSD No. 33 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by OSD No. 33 under these proceedings is described as follows, but shall not be limited to: i Parking area maintenance i Trellis/planters i Sidewalk sweeping i Tree service i Back screen wall i Shrubs i Irrigation i Ground covers i Vines i Miscellaneous planting i Annual color i Miscellaneous Estimate of Costs OSD No. 33 was formed several years ago in anticipation of development. The project has not progressed and consequently there is no maintenance required. Should the project develop in the future the District may be assessed to cover future maintenance expenses. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are assigned Equivalent Dwelling Units (EDU) based upon the number of dwelling units present on each parcel. All parcels receive 1.00 EDU per unit. The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within OSD No. 33 is 0.00. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $0.00 EDU 0.00 Fiscal Year 2023-24 Collectible per EDU $0.00 Page 136 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 21. OSD No. 33 (Broadway Business Home Village) Page | 30 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Note: OSD 33 was formed several years ago in anticipation of development. The project has not progressed and consequently there is no maintenance required. Should the project develop in the future the district may be assessed to cover future maintenance expenses. The maximum allowable Assessment rate for Fiscal Year 2023-24 is $1,792.62 per EDU. Currently OSD No. 33 is not being developed so at this time the District is not being levied. Page 137 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 22. Eastlake Maintenance District No. 1 (Zones A - E) Page | 31 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Eastlake Maintenance District No. 1 (ELMD No. 1) was formed on January 21, 1986 to fund the maintenance of various improvements and services within the boundaries of the district. The district originally consisted of two zones, Zone A and Zone B. Furthermore, Zone C was formed on June 19, 1990, Zone D was formed on September 24, 1991, and Zone E was formed on August 2, 1994. Description of District Boundaries The Eastlake Maintenance District No. 1, Zones A through E are generally located as follows: i Zone A: Contains the property within the approved Eastlake I SPA known as Eastlake Business Center, Eastlake Village Center, Eastlake Hills and Eastlake Shores. i Zone B: Eastlake Greens- generally located south of Telegraph Canyon Road, north of Olympic Parkway, west of Hunte Parkway and east of SR-125. i Zone C: Olympic Training Center- generally located south of Olympic Parkway and west of Wueste Road. i Zone D: Salt Creek I -generally located south of Proctor Valley Road, north of East "H" Street, west of Mount Miguel Road and east of SR-125. i Zone E: Three phases of the Telegraph Canyon drainage channel between Eastlake and the end of the improvements at the western boundary of Rancho del Rey east of Paseo Ladera. A copy of the boundary map for ELMD No. 1 can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by ELMD No. 1, Zone A – E under these proceedings is described as follows, but shall not be limited to: i Maintain landscaping and irrigation system in designated public street median areas; i Maintain landscaping and irrigation system in designated public maintenance easements; i Maintain supplemental lighting and provide for additional costs associated with operating supplemental lighting in designated streets. i Repair, removal, or replacement of all or any part of any improvement; i Providing for the life, growth, health, and beauty of landscaping, including cultivation, irrigation, trimming, spraying, fertilizing, or treating for disease or injury; i The removal of trimmings, rubbish, debris, and other solid waste; i Providing administration for the maintenance of improvements; i The installation of planting or landscaping; i The installation or construction of supplemental facilities; i The installation or construction of supplemental public lighting facilities; i The installation or construction of any facilities which are appurtenant to any of the foregoing or which are necessary or convenient for the maintenance or servicing thereof, including grading, clearing, removal of debris, the installation or construction, of curbs, gutters, walls, sidewalks, paving, water, irrigation, drainage, or electrical facilities; i The installation of view, sound, wrought iron and decorative walls, pedestrian fences and retaining walls; i The maintenance or servicing, or both, of any of the foregoing. i Maintain open space lots owned in fee by the City of Chula Vista, including slopes adjacent to SR 125 right-of-way. Maintenance will conform to approved landscape plans for the subject area. i Maintain landscaping and irrigation systems improvements in the street parkways adjacent to the open space lots located along East "H" Street, Mt. Miguel Road and Proctor Valley Road. Maintenance will conform to the approved landscape plans for subject area. i Maintenance, repair, and replacement of the Telegraph Canyon Channel. Page 138 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 22. Eastlake Maintenance District No. 1 (Zones A - E) Page | 32 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. The Fiscal Year 2023-24 assessment for each Zone and the associated assessment methodology is detailed as follows: Zone A To apportion the total estimated costs of ELMD No. 1, Zone A during any fiscal year, each of the parcels within the boundaries of Zone A are assigned Benefit Units (BU) based upon land use type and density. Land Use and BU Assignments Land Use Unit of Measure Benefit Units Low Density - Residential Dwelling Unit 1.25 Medium Density - Residential Dwelling Unit 1.00 Employment Park Acre 25.00 Commercial Acre 62.50 The annual Collectible per BU within the district is calculated by dividing the total annual costs by the total number of existing BU within the district to determine the annual Collectible per BU. Under no circumstances, can the annual Collectible per BU exceed the maximum assessment per BU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total BU's within ELMD No. 1, Zone A is 8,698.96. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $145,828.45 EDU 8,698.96 Fiscal Year 2023-24 Collectible per EDU $16.76 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $16.76 per BU. Page 139 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 22. Eastlake Maintenance District No. 1 (Zones A - E) Page | 33 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Zone B To apportion the total estimated costs of ELMD No. 1, Zone B during any fiscal year, each of the parcels within the boundaries of Zone B are assigned Benefit Units (BU) based upon land use type and density. Land Use and BU Assignments Land Use Unit of Measure Benefit Units Low Density - Residential Dwelling Unit 1.25 Medium Density - Residential Dwelling Unit 1.00 Employment Park Acre 25.00 Commercial Acre 62.50 The annual Collectible per BU within the district is calculated by dividing the total annual costs by the total number of existing BU within the district to determine the annual Collectible per BU. Under no circumstances, can the annual Collectible per BU exceed the maximum assessment per BU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total BU's within ELMD No. 1, Zone B is 3,375.18. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $92,694.32 EDU 3,375.18 Fiscal Year 2023-24 Collectible per EDU $27.46 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $27.46 per BU. Zone C To apportion the total estimated costs of ELMD No. 1, Zone C during any fiscal year, each of the parcels within the boundaries of Zone C are assigned Benefit Units (BU) based upon land use type and density. Land Use and BU Assignments Land Use Unit of Measure Benefit Units Low Density - Residential Dwelling Unit 1.25 Medium Density - Residential Dwelling Unit 1.00 Employment Park Acre 25.00 Commercial Acre 62.50 The annual Collectible per BU within the district is calculated by dividing the total annual costs by the total number of existing BU within the district to determine the annual Collectible per BU. Under no circumstances, can the annual Collectible per BU exceed the maximum assessment per BU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total BU's within ELMD No. 1, Zone C is 9,375.63. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $54,226.00 EDU 9,375.63 Fiscal Year 2023-24 Collectible per EDU $5.78 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $227.42 per BU. Page 140 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 22. Eastlake Maintenance District No. 1 (Zones A - E) Page | 34 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Zone D To apportion the total estimated costs of ELMD No. 1, Zone D during any fiscal year, each of the parcels within the boundaries of Zone D are assigned Equivalent Dwelling Units (EDU) based upon the estimated traffic generated by the parcel. A standard established within San Diego County is the average daily traffic (ADT) published by the San Diego Association of Governments (SANDAG). An ADT factor has been assigned to each land use type and these factors are used to estimate the traffic generated by each parcel. Zone D only contains residential parcels which have different SANDAG generation factors for each residential land use type. Therefore, the total ADT for each parcel will be directly proportional to the special benefit received by each parcel. To apportion the total estimated costs of Zone D during any fiscal year, each of the parcels within the boundaries of Zone D are assigned (EDUs) based upon land use type and ADT. Land Use and EDU Assignments Land Use ADT/Day Benefit Units Single Family Detached 10.0 1.00 Single Family Attached 8.0 0.80 Condominium Units 6.0 0.60 The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within ELMD No. 1, Zone D is 423.80. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $128,546.40 EDU 423.80 Fiscal Year 2023-24 Collectible per EDU $303.32 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $303.32 per EDU. Zone E To apportion the total estimated costs of ELMD No. 1, Zone E during any fiscal year, each of the parcels within the boundaries of Zone E are assigned Equivalent Dwelling Units (EDU) based upon land use type, density, and runoff coefficients. Land Use and EDU Assignments Land Use Runoff Density Coefficient EDU Single Family Detached 0-2 0.60 1.00 2-4 0.60 0.33 4-6 0.60 0.20 6-8 0.60 0.14 8-10 0.60 0.11 Single Family Attached 10-12 0.70 0.10 12-20 0.70 0.07 Multi-Family 20+ 0.80 0.05 Employment Park 0.90 1.50/acre Commercial 0.80 1.33/acre Church/School 0.70 1.17/acre Daycare 0.70 1.17/acre Page 141 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 22. Eastlake Maintenance District No. 1 (Zones A - E) Page | 35 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The annual Collectible per EDU within the district is calculated by dividing the total annual costs by the total number of existing EDU within the district to determine the annual Collectible per EDU. Under no circumstances, can the annual Collectible per EDU exceed the maximum assessment per EDU unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total EDUs within ELMD No. 1, Zone E is 668.03. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $13,360.60 EDU 668.03 Fiscal Year 2023-24 Collectible per EDU $20.00 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $43.24 per EDU. Page 142 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 23. Bay Boulevard Maintenance District Page | 36 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The Bay Boulevard Maintenance District was formed on July 27, 1999 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The Bay Boulevard Maintenance District is generally located along Bay Boulevard south of E Street, north of F Street, and west of I-5. A copy of the boundary map for the Bay Boulevard Maintenance District can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by the Bay Boulevard Maintenance District under these proceedings is described as follows, but shall not be limited to: i The maintenance of the parkway on the west side of Bay Boulevard between from just south of the Nature Interpretive Center entrance at "E" Street to Lagoon Drive/"F" Street. This parkway is composed of Acacia and Canary Island pine trees. Street lighting is also included. i Maintenance of the park located at the northwest corner of Bay Boulevard and Lagoon Drive and "F" Street. This park includes two separated lawn areas with picnic tables and trees, shrub and ground planting. There is also a small planted area on the northeast corner of "F" Street and Bay Blvd. Area lighting is also included. i Furnishing of services and materials needed to maintain the landscaping and lighting, including irrigation, trimming, spraying, fertilizing and treating the landscaping for disease and injury. i Removal of solid waste. i Furnishing of water for irrigation and electricity for lighting and the irrigation system. i Repairing the lighting and irrigation system. i Trash collection and disposal. Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, the annual costs will be apportioned based upon the parcel size of each parcel in acres. The annual Collectible per acre within the district is calculated by dividing the total annual costs by the total number of existing acres within the district to determine the annual Collectible per acre. Under no circumstances, can the annual Collectible per acre exceed the maximum assessment per acre unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Total acres within the Bay Boulevard Maintenance District is 6.39. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $12,749.97 EDU 6.39 Fiscal Year 2023-24 Collectible per EDU $1,995.30 Page 143 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 23. Bay Boulevard Maintenance District Page | 37 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The maximum allowable assessment rate for Fiscal Year 2023-24 is $3,913.16 per acre. Page 144 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 24. Town Centre Maintenance District Page | 38 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 The Town Centre Maintenance District was formed on November 21, 1995 to fund the maintenance of various improvements and services within the boundaries of the district. Description of District Boundaries The Town Centre Maintenance District is generally located on Third Avenue between E Street on the north and G Street on the south. A copy of the boundary map for the Town Centre Maintenance District can be located in Appendix A of this report. Description of Improvements and Services A general description of the improvements, facilities, and services to be maintained by the Town Centre Maintenance District under these proceedings is described as follows, but shall not be limited to: i Improvements on Third Avenue between “E” and “G” Streets: various improvements located between the curb and building fronts, including enhanced stamped concrete sidewalks and walkways, raised planters, container planters, shade structures with vines, supplemental tree plantings, landscaped covered bus stops, park benches, decorative street lamps, ornamental accent lighting in shade structure, decorative litter containers, ashtrays and an outdoor decorative clock. i Improvements on "F" Street between Garrett and Third Avenue (south side of street): Supplemental tree plantings enhanced concrete sidewalks, and decorative street lamps. Estimate of Costs Please see Appendix C of this report for the OSD District Cost Summary that outlines the estimated cost of operating, maintaining, servicing and administering the improvements for Fiscal Year 2023-24. The Fiscal Year 2022-23 costs are also provided for comparison purposes. Fiscal Year 2023-24 Assessment Pursuant to the Assessment Law, all parcels within the boundaries of the district that have special benefit conferred upon them as a result of the maintenance and operation of improvements are identified and the proportionate special benefit derived by each identified parcel has been determined in relationship to the entire cost of the maintenance and operation of improvements. Only parcels that receive direct and special benefit are assessed, and each parcel is assessed in proportion to the estimated benefit received. To apportion the total estimated costs of the district during any fiscal year, each of the parcels within the boundaries of the district are apportioned their special benefit received based upon the parcel size of each parcel in square feet. The annual Collectible per square foot within the district is calculated by dividing the total annual costs by the total number of existing square feet within the district to determine the annual Collectible per square foot. Under no circumstances, can the annual Collectible per square foot exceed the maximum assessment per square foot unless the district has successfully undertaken the appropriate Proposition 218 proceedings. The Fiscal Year 2023-24 assessment is spread as follows: Total Fiscal Year 2023-24 Budget $0.00 EDU 0.00 Fiscal Year 2023-24 Collectible per EDU $0.00 The maximum allowable Assessment rate for Fiscal Year 2023-24 is $0.13941 per square foot. Page 145 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 24. Town Centre Maintenance District Page | 39 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 A downtown Property and Business Improvement District (PBID) replaced Town Centre Maintenance District (LMD) in 2001. At that time, it was anticipated that the Town Centre LMD would be dissolved. However, the City determined that there was some potential long-term exposure for the City based on the remote possibility that the current PBID might not receive sufficient support for re- approval in the future. Should the PBID not be re-approved at some future date, and if the Town Centre Maintenance District were dissolved, there would no longer be a funding mechanism for downtown landscape maintenance. Based on this possibility, the Town Centre Maintenance District is kept open as a "ghost" district. This means that the City will set the maximum assessment amount for the district on an annual basis, even though property owners will not be billed on the tax roll. Should the PBID not be re-approved, the Town Centre Maintenance District remains in place and would provide the necessary funding for downtown landscape maintenance. The current PBID was renewed with the adoption of Council Resolution No. 2016-122, for a period of ten (10) years. Therefore, the Town Centre Maintenance District remains as a "ghost" district. Page 146 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 25. Assessment Diagrams Page | 40 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Assessment Diagrams The Assessment Diagrams have been submitted to the City Clerk in the format required under the provisions of the Acts. The lines and dimensions of each assessable parcel, as shown on the maps of the County Assessor for the current year, are made part of this report by reference in Appendix A. Page 147 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 26. Engineer’s Signature Page | 41 City of Chula Vista Engineer’s Report OSDs Fiscal Year 2023-24 Executed this day of 2023. ȱȱ ȱ ȱ ȱ FRANCISCO MARTINEZ JR PROFESSIONAL CIVIL ENGINEER NO. 84640 ENGINEER OF WORK CITY OF CHULA VISTA STATE OF CALIFORNIA ȱ ȱ I HEREBY CERTIFY that the enclosed Engineer’s Report, together with the Assessment Roll and Assessment Diagrams thereto attached, was filed with me on the _______ day of ____________, 2023, by adoption of Resolution No. _______by City Council. CITY CLERK CITY OF CHULA VISTA STATE OF CALIFORNIA I HEREBY CERTIFY that the enclosed Engineer’s Report, together with the Assessment Roll and Assessment Diagrams thereto attached, was approved and confirmed by the City Council of the City of Chula Vista, California on the _____day of ___________, 2023. CITY CLERK CITY OF CHULA VISTA STATE OF CALIFORNIA Page 148 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda APPENDIX A Assessment Diagrams Page 149 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CALLEC A N D E L E R O CIRCULOVE R D E OTAY LAKES R D T ELEG R A PH CANYONRDV I A SERENOAVMORGAN HILLD R LIVEOAK ST SANTALUCIARDR ID G E B A C K RD BAYLOR AVWESTMORLANDSTC A L L E JON P A L A C I O S SANTACR U Z C T WOO DVILLBLUEFALLSDRSERENACRVIAMIRALESTEPLEASANTONRD HELENAA V A G U IRREDRMA R IONCT E L M H U R S T ST GUSTINE ST B U E N A VISTAWYDEL REY CRESC E N T IA C R E S T A C A L L E SANTIAGOALONDRAAVC A L L E D U LC ESTAM V I A E S C A L A N T E BISCAY S ANTAMA D E R A AV ATV A L E N C I A LPMANNISAVPOSITAS RD STAN ISL A U S DR S ANTADELPHINAAVVIAS INUO S O A N T IOCH AV E N T R A D A AUBURNAVPACIF ICA AVDARTMO U T H S T L O SCO CHESCTX A V I E R A V H A R V A R D SOUTHVI E W CRVIAARMBELLENWOODCRE ST S T D O N C ARLOS CTCARMELAVCAMCALA B AZO M A DEL R E Y DEL RIO CTPASEORANCHEROA Z USACT R C H E B R I S T O L C TD C E R R I T O SCTVALENCIA CT RUNRDL A M AN CH APLAPACHE D R ONTSTATWATERSTM E SA GRANDEPLH A M P T O N C P A S E OMAG D A M I L L S S T Y A L E ST COLUM BIA S T CALIE N T E L P BAL B O AC RMARBELLACR MIR 0 600 1,200300 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 1 EL RANCH DEL REY UNITS 1-4 Ê Page 150 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda MAIN ST WYEORANGEA V STOTAY VAL L E Y R DWOODLARKCTSPRUCE RD TEAL ST MARLCTMAPLE DRAVMELROSE W Y SYCAMORE D RMAX AVRANCHO C TSLA T E C T LOMA LNJADE CTE R IE N S T R A S T JADE AVRAINIERCTLOTUS DRLARKHAVENDR S L A T E STMALTAAVW Y TALUS ST Q U A I L DR DO WY DEREK WY WALNUT DR LOM ACTSANDSTON E S T R IVERA C T PLATANOCTSKYLARK WYMALIT O CTTOPAZ CT T U RQUO IS E CTP RINCESSMANORCTWOOD D R G R ANDTETONCTNOLANCTM E A D O W LARKAVR I V E R A P L TOURMALINE CTMA R BLECTCTORANGED R MARL AVJASPER AVPALMRD0400800200 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 2 LARK HAVEN Ê Page 151 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OTAY LAKES R D BONITA R D V IL L A S DRP A D ERA CPAS U RREY D R BUC A L L E MES I TA CAMHOR T ON RD MAVERICK PL M IL A G R O SACT M O Y A PLSURREYPLA L L E N S C H O O L L N C A L L E E S C A R P A D A CORRALCTWRANGLE R C T MANZANO PL V ILLASCTW AGO N WHEELWYSO NGBIRD L N L A D I O S ACTCARM O N A CTR A W H I D E CT P A L E N C IA PALENCI AP LCALLELAMIRADAA LLEN S CH O O L RDB U C K A R O O LN MI L A G R OSA CR 0400800200 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 3 RANCHO ROBINHOOD UNITS 1-2 Ê Page 152 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda PA LM D R ACERO PLC ORONA V ISTA ABETODRROSALBURGALA CRES C E N T IA D R MES I TA CALASESTANCIASDR VISTAMIRANDACAMDELCERROGRANDEN RANC H O D E L R E Y P Y C RE S TVIEW POSITAS RD A C E R O S T DAMAS PLCAMELEVADO VIAARMADOCOUNTRYAVNDADELREYA B E TO CT E S C A R P A D A RIDGEVI E WCT BONITAC A N Y RIDGEVIEWWY MANZANO PL FELINO WY GLMAJESTAD LN REZKOWY PALEN C IA CT PALENCI A PL DRONEPLWO O D GLEN T RCAR L O S C A NY O N DR BURGALPCALLELAMIRADAFALLBROOK C TGREENWO OD PL 0 500 1,000250 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 4 BONITA RIDGE Ê Page 153 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda EL PLDURWARD STPATIFFANY CT LOMAVIE WC A L M A P L ROCAPLBUEN TIEMPO DRCREST DRLORI L NANY WY MESA CTDOUGLAS ST R O C ALASENDAWYPLAZA CT MDOVERCTCASSIAPLARROYO PL A N Z A W YENTRADAPLWILERDRVIACURVADA ST 0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 5 SOUTHBAY VILLAS Ê Page 154 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda TAMA Y ODRST EM I L L A N S T EL CAPITAN D R I CAM E N T R A D AROBERTAV E L S T C A M VISTA R E A LPLAZA MAREVANS AVNOLAN WYI N K O P A H S T G R E T C H E N RDNEPTUNEE M OSS S T CUYAMACAE JA M E S S T CAM LAU D R E D O N O H O E S T MONTEREY CTNITACTHELIXAVMARIA WYMYRA AVCTE ENTRADA NEPTUNE CTCTENACION NOVA P L N OVA W Y AGUA TIB FORTUN A S T NOLANLNR O M A N W Y M I SSIO N C TR A WILLOW MISSION AVOLD TELEG R A P H C A N Y O N R D S IE R R A W Y DENNIS AVE P A L O M A R D RARTHURAVSAN M I G U E L D RCLAIREA S H E F F I ELD CT WIN D SO R C R §¨¦805 0400800200 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 6 HILLTOP VISTA Ê Page 155 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda PALOMAR S T OLEANDERAVROBIN P L N T H R U S H STJUNIPER S TFINCH PLRAVEN PL OAK CT WIST E R I A ST SIP E S C R D A V E N P UINCE S TORIOLE PLNACION AV B I B L ER C P E A R L W O O D STREDWIN G R D O R I O LE C T S P A R ROW S T B I E R N A C K I OCALAAZALEA S T P E C ANPLWA X WI NGLNOAK PL HIBISCUS CTQ U A IL P LMTNVIEWLNDR §¨¦805 0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 7 ZENITH UNITS 2, 3 AND 4 Ê Page 156 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda PA LM DR OTAY LAKES R D BONITA R D V IL L A S DRACERO PLABETODRPADERAWYS E R R A N O LNS U R R E Y DRP A S E OROSALPASEOBURGAC A L L E MES I TA CAMDELCERROGRANDEN RANCHO DE L R D E LCOR ROCTA C E R O S T O V A D R CAM ESPUHUER TO PLVIEW C A L L E LAGASCAHORT O N RD MAVERICK PL M O Y A PLSURREYPLA B E TOCT A L L E N S C H O O L L N C A L L E E S C A R P A D A CORRALCT R O S A L CT WRANGLE R CT MANZANO PLVILLASCT SON GBIRD LN L A D I O SACTCARMON A C T R A W H I DE CT PALEN C IA CT PALENCI A PL PPL AZAD E L CID BURGALPLAGASCAPLCALLELAMIRADAALLEN S C H O O LRDGREENWO OD PLBUCKAROO LN MILAG R O S A CR0 500 1,000250 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 8 RANCHO ROBINHOOD UNIT 3 Ê Page 157 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda TUR MERICTRMANDEVI L E DR TELEGRAPH CANYON R D E NAPLES ST E J ST N T U C K E T DRTIERRADELREY CA M LA PAZ NEWPO RT INDIGO C A N Y O N RDDURWARD STSTEINERP A S E O DELREYSUNDOWNLNB A J O DRROUSHDAV E N P O R T L NB L A C K W O O D R D CAM D E LSOLCA LMA PL ARROYODRD A W S O NPASEOLA DERADRROCA PLBUENTIEMPODRCREST DRI LNPACIFICHILLSTRIVERASHDRAVILA WYMESA CTST R O C A R D VL A SENDAWYAMENA CTBAJO CTCALMADRPLAZA CT ME S APLDOVERCTR E D B U D R D P A S EO M ARGUERITACASSIAPLARROYO PLARROYO C TLAZO CTWI L D O A K RD A N Z A W Y H AMPSHI R E L N SESAME STELKSLN FOXBORO AVC H O L L A RD M VERACHES TNUT CTRAINB OWDRWINDING OAKDROCELOT AVC E D ARB E N D W Y LCENTERDRSAGEV I E W RE D MAPLEDRP A S O DE LUZ CRESCE NT DRMARI POSAC R 0 500 1,000250 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 9 EL RANCHO DEL REY Ê Page 158 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CALLEC A N D E L E H ST E P A L O M A R M A NDEVI L E DR TELEGRAPH CANYON RD E J S T OLEANDN A N T U C K E TDRT H R U SHS T TIERRADE L R E Y I NDIGO C A N Y ON RDDURWARD STSTEINER DRP A S E O DELREYSUNDOWNLN S T R A W B E R R Y C REEK ST VIAMIRAR IG L EYSTM T W H I T N E R A VECAM ATAJOC H ER V IL C T B C A M D EL REY MISTY CREEK ST CH PL P A S E O L A C R E S T AAVNDADELABARCA C A L L E V I A CAM BISCAY CAMMIELSANTAOLIV IA R D HITAKERAVNRANCHOSIPESC R ROUSHD R B L A C K W OOD R D CAM D E LSOLARROYODRDA WS O N DR VIASIN U OSOPASEOLADERADI AMONDDRD R BUENTIEMPODRCRESTDRORI LNCORDO V A D R S RAN C H O D E L REY P Y WY ST CAZORLAAVAS ST R O C A R D P A S E O E N T R A D A SIS AV L ASENDAWYVERIN LN BAJO CTCALMADR T MESAPLC A L REDBUD R D S A N TARGA PLCASSIAPLPASEORANCHEROLAZO CTHAM P S H IR E L N SESAME STELK SLN ESLA DRT E R DFOXBORO AVCHO L L A RD MEDICAL CENTER CTCH EST N U T C TPLAZA D ELCID OCELOT AVST MEDICALCENTERDRPASEO MAG D AN O RELL A S T DUOROD R ST SAGEV I E W MTD A N A RED MAPLEDRDELREYBLPASOD E LUZCRESCE NTDRCAMTO EST RELLA 07501,500375 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 10 EL RANCHO DEL REY 6, CASA DEL REY Ê Page 159 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda E BAYL E AFD R TAMAY O DRMIL L A N STTR A M P L HO RIZONVI E W DR S U R R E Y D R K R I S T A C T KI L E Y R D BELLEVISTA D R B E R L A N D W YFLO YDAVTERRAN O V A D R BUENTIEMPODDRLORI LNHID D E N VISTADR R E T C HEN RDL A W N VIEW D R TIFFANY WYDAVIDDR E JAMES S T W E S TVIEWDRLASENDAWYW I N DROSE WY SMOKYC R HALECRESTD R HOR T ON RD BEACONPLDOVCASSIAPLARPARKSIDEDRA L LV I E W CT GILBERT PLNEPTUNE CTCORRALCT CTENACION WILERDRKARRA CTM IS S IONCTPLAZAD E L CIDLYNN DAL E PL STARWOOD CRFIFIELD STDENNIS RDELREYBLSANIBELLE C R CAMTO§¨¦805 0 600 1,200300 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 11 HIDDEN VISTA VILLAGE Ê Page 160 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda AN D E L E R OHST OTAY LAKES RD CANYOND R C U MB R E VIE WCORRAL CA N Y ONRDLAGRAN G E R D V I A HACIEND A B R RID G E B A C K RD H A R R I L S M I LBAYLORAV R EY AVNDALORETTAS E R E NACRRCORONA VISTA REI SLI NGTRGOTHAM STDRC C LE ARBR O O K D R RUE C HATEAUIT H ACASTELMH U R S T STBUENA VISTALA CRESC E N T I A D R P O R TRE NWICKRUEM ICHELLE S T A NFORD A V L L E SANTIA G O C A M MOJAVE T R A IL R ID G E DR C A M BISCAY VA LE N C IABAYONA LPLPOSITAS RD AVNDASOLARIAAVNDAA L T A MI R A C SUNNYCR E S T L N R E Y PY CTEGALE A N A KNI G H T S F E R R YZINFANDELTRCT ELEVADO PORT DUNBARH A R V A R D STRUT G E RSAVC A N YONRID G E D R C OUNTRYVISTAS L N COE PLC I M A DEL R E Y PAAVNDADELREYB R I S T O L CT R I D G E V IEWWYPORTHARWICKCABERNETDR HE DREK SBAYPLARLOS C A N Y O N DR ETONCTS A N M I G U E L RANCH RD K E N T S T H A M P T O N C T LOYOLA CTC AR OLY NDRDUKE ST YA L E STCOLU M B I A S T OROD R FALLBRO O K CTLAKE R H IL L S ID ED R MI RAC O S T A C R ·|}þ125 0 1,000 2,000500 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 14 BONITA LONG CANYON Ê Page 161 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CALLEJONESPANAOTAY LAKES R D CANYON DRC UM B R E V I EW VIA HACIENDAREDLANDS PL RD C A L L EJON P A L A C I O S ELKHORN CTTAMPA CTAUSTIN CTVIAE N C A N T A D A P I N E R I D G E CTDRAKE CT VIA LACUESTA0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 15 BONITA HACIENDAS Ê Page 162 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CIRCULOA E J S T PASEO DEL N O R T E PASEOSARILIRIO CETIERZ TAXCO CT C A L L E DE DAMA S C O CAM ATAJOCAM D E L REY CAMMIELD R D CAM D E L SOLDORADO C T VIASINUOSOPASEODELCERROCORDOVA D R AVERDEERASHDRVIAMARAZULP A S E O E N T R A D A VIA LUNAREDOAK P L DORADOWYPASPLAZACAPOTEVISTAOAKPLCEDROC T ASEOMARGUERITADEL RIO CTPLAZA NARISCOP L A Z A A MI S T A D W I L D O A K RD OSCANAC A L L E D E L A M O R VIAMARIANA VERANODRINDINGOAKDRPASEO DE L P A S O MAPLEDR0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 17 BEL AIR RIDGE Ê Page 163 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda TUR MERICTRMANDEVI L E DR TELEGRAPH CANYON R D E N APLES ST C A MT O V ALIE NT E OLEANDERN A N T U C K E T DRS T JUNIP ER ST NEWPO R T CT INDIGO C A N Y O N RD RSTEINERDRP A S E O SUNDOWNLNA J O DRVCAM P A S OWENTOBARD W I S E S T LEECRGOULD AVC O O P E R R DWHITAKERAVSIPESCR ROUSHROBLESD R DAV E N P O R T L NB L A C K W O O D R DCALMA P L ARROYODRD A W S O NPASEOLA DERADIAMONDDRROCA PLDRCREST TERSDRPACIFICHILLSTCORIOLE PLRIVERASHDRLAST R O C A R D LACH ICADRHUM P H R E Y P L S T E FASCTR E DWING R D BAJCALMADRORIOLE CT TRIDLE PLNGDRDOVERCTR E D B U D R D PAPP P A S EO M ARGUERITASULL ARROYO C T BRADLEYPLAZA S T WI L D O A K RD HAMPSHI R E L N SESAME ST OAK PL DAVIESDRALBER S TELKSLNFOXBORO AVC H O L L A RD M EDICAL CENTER C T VERANODRRAINB OWDRWINDING OAKDRAVN D W Y PAS E O MEDICALCENTERDRSAGEV I E W RE D MAPLEDRP A S O DE LUZ CRESCE NT DRC R 0 500 1,000250 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 18 RANCHO DEL SUR Ê Page 164 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda I-805 PA LM D R E HSTE P A L O MA R STTELEGRAPH CANYON R D N A P L E S S T F I E LDB R O O KBONITARD E J ST CANYONDRC U MB R E VIE WCO OLEANDEV I L L A S DRC R NOLANACERO PLMONTESERENO A VMORGANH ILLD RREDL ANDS OSSA AVSAR IDG E B A C K RD BAYLORAMONTERA S T C A R N E ROSVALLEY S TSANTACRUZCTHANFOR D C T SIERRADRLINDSAYSTSTEINER DRCORONAVISTA ABETODRVIAMIRAL ESTESURREYDR WI L L O W S T RD P A SEOROSALPASEOBURGARAVENBUENA VI ST A WYC AM D E L REY MISTYC R EEKST LA CRESC E N T I A D R FINCH PL P A SE O LA C R E S TA CA L L E SANTIAG O T R A ICAMDELCERROGR ANDEV I A ESC AL A N TE C A M BISCAY SANTAOLIVIA RDBAYONALP N RAN C H O D E L REY PY C R ESTVIE W DRSIPESC R POSITASRD STANISLA U S B L A C K W OOD R D CAM DEL SOLA C E R O S T A RROYODRD A WS ONDRVIASINUO SO PASEOLADERASDIAMONDDFLOYDAVTERRAN O V A DRBUENTIEMPODRCREST DRLORI LNANTIOCH DR NACION AVS R A N CHOD E L REY PYDAVIDD R OSAGE AVDOUGLAS ST R O C A R D PASEO E N T R A D A OASIS AV S T CAM ELEVA D O LO SCO CHESCTVERIN LN NEPTUNE DRNAPA AVC A NYONRID G E D R COUNT RY VISTAS L N HALECRESTD R C A L L E L A G ASCAREDB U D RD S A N TAMARI AC I M A DEL RE Y PASEORANCHEROPARKSIDEDR MONARC H E DRAL LEN SCHO O L L N CORRALCTRIDG E VIEWW Y ELKS L N I T E R DFOXBOROAV CH O L L A RD APM E D ICAL CENTE R C AR LOS C A N Y O N DR W E A V ERVILLEST LA GASCAPLICALCENTERDR0 5 SBONRADUORO D R F A L LBROO K CTSAGEVI E W MTD A N A D R B U C K ARO O LN DELREYB L PASO D E LUZ E PALOMAR DM IL A G RO S ACR 0 1,200 2,400600 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 20 RANCHO DEL SUR Ê Page 165 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda MAIN ST CALLE MAYACAM CAM C A N T E R A HARD ENERGY WY CALLE P I L A R E S N I RVA N A AVENTERTAINMENT CR 0 500 1,000250 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 23 OTAY RIO BUSINESS PARK Ê Page 166 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda EH STCORRALCANYONRDI T H A CGOTHA M ST C L E A R B R THACA ST T S T O I N T DR STANFORD AVYUBA DRSUNCR E E K VAS SAR AV T U L A N E A V PORTC O RN E L L A V V A R D STRUTGERS A V COE PLCEDARSPRINGDR B R I S T O L CT C T AS H BUC ETON CTK E N T H A M P T O N C T LOYOLA CT C A R O L Y N DRD U K E Y A L E S T 0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 24 CANYON VIEW HOMES Ê Page 167 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda E S T S A N D A L W O O D D RRICHMONDPARKPL CORA L W OOD C T TOYON L NROSEMARY PLROGANRDMARIGOLDPLEUCALYPTUSCTE F L O W E R S T §¨¦805 015030075 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 26 PARK BONITA Ê Page 168 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda T E L E G R A P H C A N Y O N RDLAGRAN G E R D BROOKSTONE RD HARRILS MILL A VLEHIGHAV GRASS V A L L E Y R D EN PEAK PLSOU T H S H O RE D R VRIDGEWATERDRWO O DSPRING DR PINON HILLS RD ARBRO O K D R F O R E S T H I L L P L ANTAPAULADRSU NCREE K DRCROSSCREEK RD M OSSL A N D IN G AVDRV E R S A I L L E S RD CHATEAU CT K N I G H T S F E R R Y D R M A R TI N I Q U E DRMCCLOUD RIVER R DSTCLAIREDR MILLERSHOREVIEW PL M A R Q U E T TE RD L A T ST G E RMAINRDAS H B R O OK DR EASTLAKE D R BLUEWATER L N GENEVIEVEAVBRIDB A Y D R BUCKNELL S T MARQUISCTLAFAYETT E PL K E N T S T WATERSIDEDR D U K E S T TR LAKERIDGE CRWATERBURY ·|}þ125 0 400 800200 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 31 TELEGRAGH CANYON ESTATES Ê Page 169 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda BROADWAYJ S T K S T KEARNEY S T RIVERLAWN AVMADISON AV010020050 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM OPEN SPACE DISTRICT NO. 33 BROADWAY BUSINESS HOME VILLAGE Ê Page 170 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ROLL ING RIDGE R D CTE VIEJO EASTLAKEPYCORRAL CA N Y ONRDC R E E K R D LAGRAN G E R D MT MIGU E L RDB ROOKSTO NE RDGREENBRIARD R H A R R I L S M I L L AVVAVNDALORETTASANTRAPANICVDRREI SLI NGTRGOTHAM ST HAMDENDR CTE ANACAPA FALCON V A LLEYDRCLE ARBR OO K D R RUE C HATEAUIT H ACASTELMH U R S T STS A N T A PAULADRSIL V E R A P O R TRE NWICKRUEM ICHELLE S T A NFORD A V ROCKINGHORSEDRC A M MOJAVE A IL R ID G E DR FLAGSTA F F C M A CK E N ZIE C R EEK RD CROSSCREEK RD RIVERROC K CALL E LAQUINTALAKESHOREDRNG R EENSVIE W D RAVNDAA L T A MI R A C L U B H O U S CALLE LA M A R INA SUNNYCR E S T L N OLDTRAI L DR E L P ORTALDRCTEGALE A N A B E N T T RAI LD R CHATEAU CT KNI G H T S F E R R Y D RZINFANDELTR PC T E SANSIME O N LOS ALTO S DRPORT DUNBARH A R V A R D STRUT G E RSAVF E N T O N ST MILLERDRCOE PLLANEAVPRO C TO R M ARQ U E TTE RD B R I S T O L CT P L AZ AC ALI MARPORTHARWICKCTECA L YPSOST G E RMAINRDCROOKEDT R A IL R D EASTLAKE D R B O S W E LL RD CABERN ETDR MTN RIDGE RD APACHE DRMEEKS B A Y D R PLAZAEVAMARQUIS C TETONCTN M I G U E L RANCH RD K E N T S T H A M P T O N C T LOYOLA CTC AR OLY NDRPALO MIRA CT DUKE ST YA L E STCOLU M B I A S T KU H N DRAUGUSTAPLLAKE RIDGE CR L A CO H I L L S ID ED R E A S T R IDGELPMI RAC O S T A C R ·|}þ125 0 1,000 2,000500 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM EASTLAKE MAINTENANCE DISTRICT NO. 1 ZONE A Ê Page 171 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RUS T LI N G L N HUNTEP Y CAMTOMO N T A R O S A B IR C H R DDAVTRAILWOOD AVEASTLAKEPYMAGDALENAAVB A T T L E C R E E K R D NGE R D B U RGUNDYDRLOKOYA DR D R A G O N FLYSTB ROOKSTO NE RDURN EYSTQUIETTRAILDRGREENBRIARD R STPICKETFENCEDRCOPPERPENNYDRR I L S M I L L AVV I E W PARKWYASPENGENRDH U M M INGBIR D ST NORTHWDISCOVERYFAL L S SCOMPAS STRAPANICVSANTAROSADRG E Y S E R V I L L E STRNDR PEDESTRI A NACCESSO K D REAU NOB LE C A N Y O N RD S A N T A PAULADRSIL V E R A DODREXPLORATI ONF A L LS D R S UTTE R BUTTE S ST S I L VERO AKPLSILVERSPR I N G S D REK RD CROSSCREEK RD SUTTERRIDGEDRROC K R D M T B ULLIONDR E V E N I N GST A R STGRANITESPRING S DR NORTH CREEK S I DEDRLAKESHOREDRNG R EENSVIE W D R SR O A D SSTRDS G R E E N S VIE W DR C L U B H O U S E D R OAKPOINT AVTAB LE R OCKAVF E R N VALLEYRDHI D DEN DRELMWO O D CT BRYCECANY O NA V CHATEAU CT OAKSPRINGSDRT S F E R R Y D R W IN DINGW A L K STOLDJANALRANCHR D S T Y O S E MI T EDRF E N T O N ST RANZAPLMILLERDRRIVIE R ADRLANEAVM ARQ U E TTE RD ST G E RMAINRDC O Y OTE RIDGETREASTLAKE D R MTNASHAV B O S W E LL RD ER STLONGVIEWDREKS BA Y D R VALLEJOMILLS ST BLAIRWOOD AV G R E E N RI V ERDRMARQUIS C TN T S T PALO MIRA CT SHOWROOMPLKE ST INDI A N C R E E K P L KUH N DRHAAUGUSTAPLLAKE RIDGE CR AL A COSTA AV R E A S T R IDGELP·|}þ125 0 1,000 2,000500 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM EASTLAKE MAINTENANCE DISTRICT NO. 1 ZONE B Ê Page 172 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda V I E NT O ESTRELLA WHITE PI N E C T CIELO C I RCULOSILVE R MED A L R DQUIETTRAILDRSTPICKETFENCEDRCOPPERPENNYDRS A G E ST ON RDHORE A CRESDRNY O N W YDR ST A R ST S O U T H CREEKSIDEW E E P I N G W ILLOWRDAPPALACHI ANP L F E R N VALLEYHIDDEN DR OLYMPICV I S TA R D OAK SPPRIVATEDYHI KE RS TRAILDRW U EST E RD0 750 1,500375 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM EASTLAKE MAINTENANCE DISTRICT NO. 1 ZONE C Ê Page 173 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CALLEBENDITOROLLINGRIDGE RD LAGO M A D E R O ALICANTE CV R DLAGOVE NTANACABO BAHIANEW HAVE N D RHARTFORDST R C E L O NAI RC U L O C O RONAD O P O R T CARDIFFCA LLE CATAR INA REI SLI NGTRHAMDEN D R CHATEAULLE RIVERBENDW YMACKENZI EDGEWATER DRCLEARWATERPL HUNTINGTO N POINTRDC A L L E LAKESHOREDRL EL A MAR I N A N O R T H S H O R E DRCALLE FERNANDO U C A R UE P A R C C H A R D O N N A Y TR ILLERDRA R AIS O PORTSTIRLING P L AZ ACALI MARSTONECREEKPLCTE CALYPSOOCEANBREEZEWYWINDYWYEASTLAKE R MTN RIDGE RDA VNDAANTONIOAVNDAMANTILLABRIDGEPORTA L OS OS O S WATE RTOWN L NWOODSIDE CTAZACAMBRIAEASTSHORETR D R WATERBURY·|}þ125 0400800200 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM EASTLAKE MAINTENANCE DISTRICT NO. 1 ZONE D Ê Page 174 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda CALLEC A N D E L E H ST E P A L O M A R M A NDEVI L E DR TELEGRAPH CANYON RD E J S T OLEANDN A N T U C K E TDRT H R U SHS T TIERRADE L R E Y I NDIGO C A N Y ON RDDURWARD STSTEINER DRP A S E O DELREYSUNDOWNLN S T R A W B E R R Y C REEK ST VIAMIRAR IG L EYSTM T W H I T N E R A VECAM ATAJOC H ER V IL C T B C A M D EL REY MISTY CREEK ST CH PL P A S E O L A C R E S T AAVNDADELABARCA C A L L E V I A CAM BISCAY CAMMIELSANTAOLIV IA R D HITAKERAVNRANCHOSIPESC R ROUSHD R B L A C K W OOD R D CAM D E LSOLARROYODRDA WS O N DR VIASIN U OSOPASEOLADERADI AMONDDRD R BUENTIEMPODRCRESTDRORI LNCORDO V A D R S RAN C H O D E L REY P Y WY ST CAZORLAAVAS ST R O C A R D P A S E O E N T R A D A SIS AV L ASENDAWYVERIN LN BAJO CTCALMADR T MESAPLC A L REDBUD R D S A N TARGA PLCASSIAPLPASEORANCHEROLAZO CTHAM P S H IR E L N SESAME STELK SLN ESLA DRT E R DFOXBORO AVCHO L L A RD MEDICAL CENTER CTCH EST N U T C TPLAZA D ELCID OCELOT AVST MEDICALCENTERDRPASEO MAG D AN O RELL A S T DUOROD R ST SAGEV I E W MTD A N A RED MAPLEDRDELREYBLPASOD E LUZCRESCE NTDRCAMTO EST RELLA 0 750 1,500375 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM EASTLAKE MAINTENANCE DISTRICT NO. 1 ZONE E Ê Page 175 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda BAYBLD R LA G OON D R NAMED34FST§¨¦5 0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM BAY BLVD. Ê Page 176 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda F S T G S T MADRON A S T3RD AVCYPRESS DAV IDSON S T WY GLOVERAVSAYLOR D R GARRETT AVLANSLEY W YWYK DEL MAR CLOS FLORES STLANDIS AVTWIN OAKS AV0250500125 Feet CITY OF CHULA VISTA ASSESSMENT DIAGRAM TOWN CENTRE Ê Page 177 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda APPENDIX B Definitions of Budgeted Items Page 178 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Definitions Of Budgeted Items City of Chula Vista Engineer’s Report OSDs Fiscal Year 2020-21 The following definitions describe the costs that are included in the OSDs estimate of costs shown in Appendix C of this report: Personnel Services include the cost for non-traditional department staff members, such as legal review. Utility Charges include the furnishing of electricity for irrigation controllers, pedestrian lighting and telephone service to centralized irrigation controllers. Trash Collection & Disposal Fees include forty cubic yard roll off dumpsters to facilitate fire clearances, trail clearances and general large-scale clean-up projects. Water Charges include the furnishing of water required for the operation and maintenance of the landscaping facilities. Services to Maintain Structures and Grounds include irrigation system repair and replacements. This pays for any labor costs involved with the installation of these parts. City Staff Services include the costs of all particular departments and staff of the City for providing the coordination of OSD services, inspections, annual bid management, operations and maintenance of the improvements, response to public concerns, public education, and procedures associated with the levy and collection of assessments. Contractual Services include the furnishing of landscaping companies to perform landscape maintenance tasks and the services of other experts typically outside the realm of routine landscape maintenance. Landscape Supplies include plant material for the re-vegetation of bare areas, crop failures or enhanced supplemental plantings. Materials to Maintain Structures and Grounds include the furnishing of parts and materials for the correct operation of systems. This pays for the parts/materials only, not any labor involved in the installation. Backflow Certification includes annual State of California required testing, repair and replacement of backflow prevention devices. Professional Services include unique contracts required for landscaping not covered under “Contractual Services.” Supplementals include labor associated with one-time maintenance. Other Commodities include the product costs of one-time maintenance. Advertising includes the furnishing of advertised bidding announcements for landscape contracts in local newspapers. Transfer: Corporate Yard Debt Services include a portion of the debt service due on the property where services are coordinated. Storm Maintenance includes the maintenance of detention basins, storm drains, catch basins, hydrodynamic devices, infiltration basins and all other facilities that are directly related to storm water quality control. Special Maintenance Fund includes maintenance items that occur as needed over a number of years (deferred maintenance costs). Operating Reserve Collection is the amount collected to maintain reserves; the operating reserve will be funded through the annual collection of assessments. Page 179 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda APPENDIX C District Cost Summary Page 180 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 1 El Rancho Del Rey Units 1-4 Direct Costs FY 2022-23 FY 2023-24 Utility Charges $1,171.00 $1,171.00 Trash Collection & Disposal Fees $0.00 $0.00 Water Charges $39,207.00 $39,207.00 City Staff Services $6,512.00 $5,910.00 Contractual Services $38,707.00 $40,639.00 Material to maintain structures, grounds $2,293.00 $2,293.00 Professional Services $38.00 $40.00 Required Backflow Inspection Estimate $702.00 $702.00 Total Direct Costs $88,630.00 $89,962.00 Indirect Costs Administration Costs $5,428.00 $5,403.00 Assessment Engineer $1,144.00 $1,273.00 Auditor Controller $64.80 $64.80 Total Indirect Costs $6,636.80 $6,740.80 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($65.59)$2,553.99 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $95,201.21 $99,256.79 Equivalent Dwelling Units (EDUs)(1)655.20 655.20 Rate per EDU $145.30 $151.49 Max Rate per EDU $145.30 $151.49 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $95,266.80 $96,702.80 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $95,200.54 $99,256.79 Surplus / (Deficit) ($66.26)$2,553.99 Reserve Account Activity Operating Reserves Beginning Balance(2)$48,294.54 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $48,294.54 Capital Improvement Beginning Balance(2)$38,723.86 Capital Improvement Replenishment $2,553.99 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $41,277.85 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 181 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 2 Lark Haven Direct Costs FY 2022-23 FY 2023-24 Utility Charges $352.00 $352.00 Water Charges $5,155.00 $5,155.00 City Staff Services $914.00 $911.00 Contractual Services $5,695.00 $5,741.00 Material to maintain structures, grounds $1,203.00 $1,203.00 Professional Services $19.00 $20.00 Required Backflow Inspection Estimate $78.00 $78.00 Total Direct Costs $13,416.00 $13,460.00 Indirect Costs Administration Costs $3,004.00 $3,007.00 Assessment Engineer $294.00 $326.00 Auditor Controller $24.80 $24.80 Total Indirect Costs $3,322.80 $3,357.80 Levy Breakdown Operating Reserve Replenishment/(Contribution) ($23.60)$606.68 Capital Improvement Replenishment/(Contribution)$0.00 $0.00 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $16,715.20 $17,424.48 Equivalent Dwelling Units (EDUs)(1)248.00 248.00 Rate per EDU $67.40 $70.26 Max Rate per EDU $67.40 $70.27 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $16,738.80 $16,817.80 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $16,715.20 $17,424.48 Surplus / (Deficit) ($23.60)$606.68 Reserve Account Activity Operating Reserves Beginning Balance(2)($143.94) Operating Reserves Replenishment $606.68 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $462.74 Capital Improvement Beginning Balance(2)$0.00 Capital Improvement Replenishment $0.00 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $0.00 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 182 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 3 Rancho Robinhood Direct Costs FY 2022-23 FY 2023-24 Utility Charges $1,314.00 $1,314.00 Trash Collection & Disposal Fees $400.00 $0.00 Water Charges $16,203.00 $16,203.00 City Staff Services $6,587.00 $6,335.00 Contractual Services $26,313.00 $27,625.00 Material to maintain structures, grounds $1,000.00 $1,000.00 Professional Services $13.00 $14.00 Required Backflow Inspection Estimate $780.00 $780.00 Total Direct Costs $52,610.00 $53,271.00 Indirect Costs Administration Costs $4,659.00 $4,665.00 Assessment Engineer $861.00 $958.00 Auditor Controller $12.70 $12.70 Total Indirect Costs $5,532.70 $5,635.70 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$467.80 $2,200.62 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $58,610.50 $61,107.32 Equivalent Dwelling Units (EDUs)(1)127.00 127.00 Rate per EDU $461.50 $481.16 Max Rate per EDU $461.51 $481.17 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $58,142.70 $58,906.70 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $58,610.50 $61,107.32 Surplus / (Deficit)$467.80 $2,200.62 Reserve Account Activity Operating Reserves Beginning Balance(2)$29,409.08 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $29,409.08 Capital Improvement Beginning Balance(2)$24,564.88 Capital Improvement Replenishment $2,200.62 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $26,765.50 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 183 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 4 Bonita Ridge Direct Costs FY 2022-23 FY 2023-24 Utility Charges $2,422.00 $2,422.00 Trash Collection & Disposal Fees $400.00 $400.00 Water Charges $17,861.00 $16,473.00 City Staff Services $6,721.00 $7,050.00 Contractual Services $76,099.00 $79,900.00 Material to maintain structures, grounds $1,000.00 $1,000.00 Professional Services $133.00 $140.00 Required Backflow Inspection Estimate $858.00 $858.00 Total Direct Costs $105,494.00 $108,243.00 Indirect Costs Administration Costs $5,986.00 $5,948.00 Assessment Engineer $1,428.00 $1,589.00 Auditor Controller $20.80 $20.80 Total Indirect Costs $7,434.80 $7,557.80 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($11,541.28) ($10,095.20) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $101,387.52 $105,705.60 Equivalent Dwelling Units (EDUs)(1)208.00 208.00 Rate per EDU $487.44 $508.20 Max Rate per EDU $487.45 $508.21 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $112,928.80 $115,800.80 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $101,387.52 $105,705.60 Surplus / (Deficit) ($11,541.28) ($10,095.20) Reserve Account Activity Operating Reserves Beginning Balance(2)$57,830.45 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $57,830.45 Capital Improvement Beginning Balance(2)$30,763.80 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($10,095.20) Capital Improvement Ending Balance $20,668.60 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 184 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 5 Southbay Villas Direct Costs FY 2022-23 FY 2023-24 Utility Charges $308.00 $308.00 Water Charges $22,451.00 $22,834.00 City Staff Services $5,592.00 $5,575.00 Contractual Services $18,861.00 $18,618.00 Material to maintain structures, grounds $1,384.00 $1,384.00 Professional Services $11.00 $12.00 Required Backflow Inspection Estimate $234.00 $234.00 Total Direct Costs $48,841.00 $48,965.00 Capital Improvement Projects Project: Revegetation of landscape areas $6,000.00 $0.00 Project: Vegetation Management $0.00 $6,000.00 Total Capital Improvement Costs $6,000.00 $6,000.00 Indirect Costs Administration Costs $4,730.00 $4,747.00 Assessment Engineer $861.00 $958.00 Auditor Controller $12.20 $12.20 Total Indirect Costs $5,603.20 $5,717.20 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($2,455.16) ($221.44) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $57,989.04 $60,460.76 Equivalent Dwelling Units (EDUs)(1)122.00 122.00 Rate per EDU $475.32 $495.58 Max Rate per EDU $475.34 $495.59 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $54,444.20 $54,682.20 Total Capital Improvement Costs $6,000.00 $6,000.00 Total Assessment $57,989.04 $60,460.76 Surplus / (Deficit) ($2,455.16) ($221.44) Reserve Account Activity Operating Reserves Beginning Balance(2)$27,296.83 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $27,296.83 Capital Improvement Beginning Balance(2)$72,890.19 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($221.44) Capital Improvement Ending Balance $72,668.75 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 185 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 6 Hilltop Vista Direct Costs FY 2022-23 FY 2023-24 Utility Charges $604.00 $604.00 Water Charges $12,579.00 $13,928.00 City Staff Services $2,299.00 $2,528.00 Contractual Services $11,387.00 $9,857.00 Material to maintain structures, grounds $1,200.00 $1,200.00 Professional Services $30.00 $32.00 Required Backflow Inspection Estimate $234.00 $234.00 Total Direct Costs $28,333.00 $28,383.00 Capital Improvement Projects Project: Vegetation Management $10,000.00 $10,000.00 Total Capital Improvement Costs $10,000.00 $10,000.00 Indirect Costs Administration Costs $3,851.00 $3,789.00 Assessment Engineer $577.00 $642.00 Auditor Controller $16.20 $16.20 Total Indirect Costs $4,444.20 $4,447.20 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($4,697.48) ($3,127.24) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $38,079.72 $39,702.96 Equivalent Dwelling Units (EDUs)(1)162.00 162.00 Rate per EDU $235.06 $245.08 Max Rate per EDU $235.08 $245.09 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $32,777.20 $32,830.20 Total Capital Improvement Costs $10,000.00 $10,000.00 Total Assessment $38,079.72 $39,702.96 Surplus / (Deficit) ($4,697.48) ($3,127.24) Reserve Account Activity Operating Reserves Beginning Balance(2)$16,383.92 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $16,383.92 Capital Improvement Beginning Balance(2)$73,170.55 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($3,127.24) Capital Improvement Ending Balance $70,043.31 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 186 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 7 Zenith Direct Costs FY 2022-23 FY 2023-24 Utility Charges $241.00 $241.00 Water Charges $6,847.00 $5,000.00 City Staff Services $1,426.00 $1,426.00 Contractual Services $13,596.00 $14,277.00 Material to maintain structures, grounds $250.00 $256.00 Automotive Equipment $0.00 $0.00 Wireless and Data Access Charges $0.00 $0.00 Total Direct Costs $22,360.00 $21,200.00 Indirect Costs Administration Costs $3,304.00 $3,239.00 Assessment Engineer $294.00 $326.00 Auditor Controller $10.00 $10.00 Total Indirect Costs $3,608.00 $3,575.00 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 ($2,121.01) Capital Improvement Replenishment/(Contribution) ($9,550.00) ($5,535.99) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $16,418.00 $17,118.00 Equivalent Dwelling Units (EDUs)(1)100.00 100.00 Rate per EDU $164.18 $171.18 Max Rate per EDU $164.20 $171.19 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $25,968.00 $24,775.00 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $16,418.00 $17,118.00 Surplus / (Deficit) ($9,550.00) ($7,657.00) Reserve Account Activity Operating Reserves Beginning Balance(2)$12,369.41 Operating Reserves Replenishment $0.00 Operating Reserves Contribution ($2,121.01) Operating Reserves Ending Balance $10,248.40 Capital Improvement Beginning Balance(2)$5,535.99 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($5,535.99) Capital Improvement Ending Balance $0.00 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 187 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 8 Rancho Robinhood Unit 3 Direct Costs FY 2022-23 FY 2023-24 Utility Charges $775.00 $775.00 Trash Collection & Disposal Fees $250.00 $250.00 Water Charges $14,866.00 $14,866.00 City Staff Services $8,806.00 $9,264.00 Contractual Services $47,564.00 $48,893.00 Material to maintain structures, grounds $2,159.00 $2,159.00 Professional Services $48.00 $51.00 Required Backflow Inspection Estimate $624.00 $624.00 Total Direct Costs $75,092.00 $76,882.00 Indirect Costs Administration Costs $5,817.00 $5,359.00 Assessment Engineer $1,144.00 $1,273.00 Auditor Controller $11.00 $11.00 Total Indirect Costs $6,972.00 $6,643.00 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$455.80 $2,510.40 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $82,519.80 $86,035.40 Equivalent Dwelling Units (EDUs)(1)110.00 110.00 Rate per EDU $750.18 $782.14 Max Rate per EDU $750.18 $782.14 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $82,064.00 $83,525.00 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $82,519.80 $86,035.40 Surplus / (Deficit)$455.80 $2,510.40 Reserve Account Activity Operating Reserves Beginning Balance(2)$41,705.64 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $41,705.64 Capital Improvement Beginning Balance(2)$56,546.62 Capital Improvement Replenishment $2,510.40 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $59,057.02 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 188 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 9 El Rancho Del Rey Direct Costs FY 2022-23 FY 2023-24 Utility Charges $347.00 $347.00 Water Charges $32,800.00 $32,800.00 City Staff Services $8,120.00 $8,952.00 Contractual Services $20,325.00 $24,241.00 Material to maintain structures, grounds $1,684.00 $1,684.00 Professional Services $75.00 $79.00 Required Backflow Inspection Estimate $546.00 $546.00 Total Direct Costs $63,897.00 $68,649.00 Indirect Costs Administration Costs $5,929.00 $5,097.00 Assessment Engineer $1,144.00 $1,273.00 Auditor Controller $38.40 $38.40 Total Indirect Costs $7,111.40 $6,408.40 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$10,842.60 $10,274.00 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $81,851.00 $85,331.40 Equivalent Dwelling Units (EDUs)(1)385.00 385.00 Rate per EDU $212.60 $221.64 Max Rate per EDU $212.60 $221.66 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $71,008.40 $75,057.40 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $81,851.00 $85,331.40 Surplus / (Deficit)$10,842.60 $10,274.00 Reserve Account Activity Operating Reserves Beginning Balance(2)$37,471.84 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $37,471.84 Capital Improvement Beginning Balance(2)$23,716.21 Capital Improvement Replenishment $10,274.00 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $33,990.21 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 189 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 10 El Rancho Del Rey 6 & Casa Del Rey Direct Costs FY 2022-23 FY 2023-24 Utility Charges $642.00 $642.00 Trash Collection & Disposal Fees $0.00 $0.00 Water Charges $32,934.00 $32,113.00 City Staff Services $8,578.00 $9,861.00 Contractual Services $40,014.00 $33,498.00 Landscape Supplies $0.00 $0.00 Material to maintain structures, grounds $1,300.00 $1,300.00 Professional Services $96.00 $101.00 Required Backflow Inspection Estimate $468.00 $468.00 Total Direct Costs $84,032.00 $77,983.00 Capital Improvement Projects Project: Vegetation Management $0.00 $10,000.00 Total Capital Improvement Costs $0.00 $10,000.00 Indirect Costs Administration Costs $6,990.00 $5,707.00 Assessment Engineer $1,144.00 $1,273.00 Auditor Controller $65.30 $65.30 Total Indirect Costs $8,199.30 $7,045.30 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$1,989.10 $3,205.89 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $94,220.40 $88,234.19 Equivalent Dwelling Units (EDUs)(1)656.76 656.76 Rate per EDU $143.46 $149.57 Max Rate per EDU $143.46 $149.57 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $92,231.30 $85,028.30 Total Capital Improvement Costs $0.00 $10,000.00 Total Assessment $94,218.80 $98,234.19 Surplus / (Deficit)$1,987.50 $3,205.89 Reserve Account Activity Operating Reserves Beginning Balance(2)$42,457.29 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $42,457.29 Capital Improvement Beginning Balance(2)$114,766.09 Capital Improvement Replenishment $3,205.89 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $117,971.98 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 190 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 11 Hidden Vista Villa Direct Costs FY 2022-23 FY 2023-24 Utility Charges $1,250.00 $1,250.00 Trash Collection & Disposal Fees $0.00 $0.00 Water Charges $70,461.00 $70,450.00 City Staff Services $18,323.00 $21,150.00 Contractual Services $76,443.00 $80,055.00 Material to maintain structures, grounds $3,240.00 $3,240.00 Professional Services $214.00 $225.00 Required Backflow Inspection Estimate $936.00 $936.00 Total Direct Costs $170,867.00 $177,306.00 Capital Improvement Projects Project: Vegetation Management $0.00 $4,000.00 Total Capital Improvement Costs $0.00 $4,000.00 Indirect Costs Administration Costs $11,299.00 $8,472.00 Assessment Engineer $2,562.00 $2,852.00 Auditor Controller $87.90 $87.90 Total Indirect Costs $13,948.90 $11,411.90 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$6,985.33 $7,254.06 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $191,801.23 $195,971.96 Equivalent Dwelling Units (EDUs)(1)1,321.04 1,321.04 Rate per EDU $145.19 $151.37 Max Rate per EDU $145.19 $151.37 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $184,815.90 $188,717.90 Total Capital Improvement Costs $0.00 $4,000.00 Total Assessment $191,792.84 $199,971.96 Surplus / (Deficit)$6,976.94 $7,254.06 Reserve Account Activity Operating Reserves Beginning Balance(2)$94,237.13 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $94,237.13 Capital Improvement Beginning Balance(2)$170,730.92 Capital Improvement Replenishment $7,254.06 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $177,984.98 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 191 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 14 Bonita Long Canyon Direct Costs FY 2022-23 FY 2023-24 Utility Charges $4,408.00 $4,408.00 Trash Collection & Disposal Fees $2,500.00 $2,500.00 Water Charges $154,230.00 $154,230.00 City Staff Services $36,892.00 $39,876.00 Contractual Services $152,352.00 $159,956.00 Material to maintain structures, grounds $4,933.00 $4,933.00 Professional Services $315.00 $331.00 Wireless and Data Access Charges $1,344.00 $1,412.00 Required Backflow Inspection Estimate $2,652.00 $2,652.00 Total Direct Costs $359,626.00 $370,298.00 Capital Improvement Projects Project: Vegetation Management $10,000.00 $8,000.00 Total Capital Improvement Costs $10,000.00 $8,000.00 Indirect Costs Administration Costs $17,798.00 $14,814.00 Assessment Engineer $5,680.00 $6,325.00 Auditor Controller $86.20 $86.20 Total Indirect Costs $23,564.20 $21,225.20 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$9,105.20 $19,908.76 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $402,295.40 $419,431.96 Equivalent Dwelling Units (EDUs)(1)862.00 862.00 Rate per EDU $466.70 $486.58 Max Rate per EDU $466.70 $486.58 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $383,190.20 $391,523.20 Total Capital Improvement Costs $10,000.00 $8,000.00 Total Assessment $402,295.40 $419,431.96 Surplus / (Deficit)$9,105.20 $19,908.76 Reserve Account Activity Operating Reserves Beginning Balance(2)$195,497.29 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $195,497.29 Capital Improvement Beginning Balance(2)$183,052.48 Capital Improvement Replenishment $19,908.76 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $202,961.24 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 192 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 15 Bonita Haciendas Direct Costs FY 2022-23 FY 2023-24 Utility Charges $346.00 $346.00 Water Charges $7,944.00 $7,944.00 City Staff Services $1,286.00 $1,283.00 Contractual Services $7,287.00 $7,652.00 Landscape Supplies $0.00 $0.00 Material to maintain structures, grounds $1,000.00 $1,000.00 Professional Services $19.00 $20.00 Wireless and Data Access Charges $137.00 $144.00 Required Backflow Inspection Estimate $390.00 $390.00 Total Direct Costs $18,409.00 $18,779.00 Indirect Costs Administration Costs $3,668.00 $3,671.00 Assessment Engineer $294.00 $326.00 Auditor Controller $5.70 $5.70 Total Indirect Costs $3,967.70 $4,002.70 Levy Breakdown Operating Reserve Replenishment/(Contribution)$3,144.48 $3,827.04 Capital Improvement Replenishment/(Contribution)$0.00 $0.00 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $25,521.18 $26,608.74 Equivalent Dwelling Units (EDUs)(1)57.00 57.00 Rate per EDU $447.74 $466.82 Max Rate per EDU $447.76 $466.83 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $22,376.70 $22,781.70 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $25,521.18 $26,608.74 Surplus / (Deficit)$3,144.48 $3,827.04 Reserve Account Activity Operating Reserves Beginning Balance(2)$1,880.44 Operating Reserves Replenishment $3,827.04 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $5,707.48 Capital Improvement Beginning Balance(2)$0.00 Capital Improvement Replenishment $0.00 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $0.00 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 193 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 17 Bel Air Ridge Direct Costs FY 2022-23 FY 2023-24 City Staff Services $436.00 $479.00 Contractual Services $6,257.00 $6,571.00 Landscape Supplies $0.00 $0.00 Material to maintain structures, grounds $0.00 $0.00 Automotive Equipment $0.00 $0.00 Professional Services $11.00 $12.00 Total Direct Costs $6,704.00 $7,062.00 Indirect Costs Administration Costs $2,803.00 $2,810.00 Assessment Engineer $294.00 $326.00 Auditor Controller $4.60 $4.60 Total Indirect Costs $3,101.60 $3,140.60 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$53.12 $76.56 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $9,858.72 $10,279.16 Equivalent Dwelling Units (EDUs)(1)46.00 46.00 Rate per EDU $214.32 $223.46 Max Rate per EDU $214.33 $223.46 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $9,805.60 $10,202.60 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $9,858.72 $10,279.16 Surplus / (Deficit)$53.12 $76.56 Reserve Account Activity Operating Reserves Beginning Balance(2)$5,083.21 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $5,083.21 Capital Improvement Beginning Balance(2)$6,706.16 Capital Improvement Replenishment $76.56 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $6,782.72 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 194 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 18 Rancho Del Sur Direct Costs FY 2022-23 FY 2023-24 Utility Charges $938.00 $938.00 Water Charges $66,264.00 $72,686.00 City Staff Services $21,287.00 $26,154.00 Contractual Services $70,432.00 $73,754.00 Material to maintain structures, grounds $3,662.00 $3,662.00 Professional Services $84.00 $89.00 Required Backflow Inspection Estimate $936.00 $936.00 Total Direct Costs $163,603.00 $178,219.00 Capital Improvement Projects Project: Lighting Repairs $8,000.00 $0.00 Project: Revegetation of landscape areas $30,000.00 $15,000.00 Project: Vegetation Management $0.00 $5,000.00 Total Capital Improvement Costs $38,000.00 $20,000.00 Indirect Costs Administration Costs $14,155.00 $9,288.00 Assessment Engineer $2,845.00 $3,168.00 Auditor Controller $49.20 $49.20 Total Indirect Costs $17,049.20 $12,505.20 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($31,172.20) ($23,244.20) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $187,480.00 $187,480.00 Equivalent Dwelling Units (EDUs)(1)436.00 436.00 Rate per EDU $430.00 $430.00 Max Rate per EDU $506.46 $528.03 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $180,652.20 $190,724.20 Total Capital Improvement Costs $38,000.00 $20,000.00 Total Assessment $187,480.00 $187,480.00 Surplus / (Deficit) ($31,172.20) ($23,244.20) Reserve Account Activity Operating Reserves Beginning Balance(2)$95,227.19 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $95,227.19 Capital Improvement Beginning Balance(2)$326,756.71 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($23,244.20) Capital Improvement Ending Balance $303,512.51 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 195 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 1 Desilting Basin at East H Street Direct Costs FY 2022-23 FY 2023-24 City Staff Services $25,431.00 $26,002.00 Contractual Services $0.00 $0.00 Storm Maintenance $31,100.00 $34,210.00 Total Direct Costs $56,531.00 $60,212.00 Capital Improvement Projects Project: Storm Water Access Road $50,000.00 $0.00 Project: Rice Canyon Channel maintenance $50,000.00 $50,000.00 Total Capital Improvement Costs $100,000.00 $50,000.00 Indirect Costs Administration Costs $5,265.00 $4,694.00 Assessment Engineer $861.00 $958.00 Auditor Controller $282.40 $282.40 Total Indirect Costs $6,408.40 $5,934.40 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($93,921.79) ($44,188.64) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $69,017.61 $71,957.76 Equivalent Dwelling Units (EDUs)(1)881.95 881.95 Rate per EDU $78.26 $81.59 Max Rate per EDU $78.26 $81.59 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $62,939.40 $66,146.40 Total Capital Improvement Costs $100,000.00 $50,000.00 Total Assessment $68,990.10 $71,957.76 Surplus / (Deficit) ($93,949.30) ($44,188.64) Reserve Account Activity Operating Reserves Beginning Balance(2)$33,028.93 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $33,028.93 Capital Improvement Beginning Balance(2)$480,289.64 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($44,188.64) Capital Improvement Ending Balance $436,100.99 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 196 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 2 Rice Canyon Trail Area Direct Costs FY 2022-23 FY 2023-24 Utility Charges $0.00 $0.00 Water Charges $0.00 $0.00 City Staff Services $836.00 $922.00 Contractual Services $11,499.00 $12,074.00 Material to maintain structures, grounds $0.00 $0.00 Automotive Equipment $0.00 $0.00 Professional Services $38.00 $40.00 Total Direct Costs $12,373.00 $13,036.00 Indirect Costs Administration Costs $3,480.00 $3,394.00 Assessment Engineer $294.00 $326.00 Auditor Controller $221.00 $221.00 Total Indirect Costs $3,995.00 $3,941.00 Levy Breakdown Operating Reserve Replenishment/(Contribution)$7,093.68 $7,484.15 Capital Improvement Replenishment/(Contribution)$0.00 $0.00 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $23,461.68 $24,461.15 Equivalent Dwelling Units (EDUs)(1)3,957.82 3,957.82 Rate per EDU $5.93 $6.18 Max Rate per EDU $5.93 $6.18 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $16,368.00 $16,977.00 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $23,444.00 $24,461.15 Surplus / (Deficit)$7,076.00 $7,484.15 Reserve Account Activity Operating Reserves Beginning Balance(2)($96,455.32) Operating Reserves Replenishment $7,484.15 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance ($88,971.17) Capital Improvement Beginning Balance(2)$0.00 Capital Improvement Replenishment $0.00 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $0.00 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 197 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 3 East H Street Direct Costs FY 2022-23 FY 2023-24 Utility Charges $936.00 $1,090.00 Water Charges $10,744.00 $10,744.00 City Staff Services $2,838.00 $3,065.00 Contractual Services $24,581.00 $30,811.00 Material to maintain structures, grounds $500.00 $500.00 Required Backflow Inspection Estimate $156.00 $156.00 Total Direct Costs $39,755.00 $46,366.00 Indirect Costs Administration Costs $4,353.00 $4,445.00 Assessment Engineer $861.00 $958.00 Auditor Controller $342.90 $342.90 Total Indirect Costs $5,556.90 $5,745.90 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$6,656.59 $2,068.16 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $51,968.49 $54,180.06 Equivalent Dwelling Units (EDUs)(1)6,144.79 6,144.53 Rate per EDU $8.46 $8.82 Max Rate per EDU $8.46 $8.82 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $45,311.90 $52,111.90 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $51,917.02 $54,180.06 Surplus / (Deficit)$6,605.12 $2,068.16 Reserve Account Activity Operating Reserves Beginning Balance(2)$26,011.68 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $26,011.68 Capital Improvement Beginning Balance(2)$7,696.02 Capital Improvement Replenishment $2,068.16 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $9,764.17 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 198 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 4 SPA I Phase 1 Business Center Direct Costs FY 2022-23 FY 2023-24 Utility Charges $1,384.00 $1,384.00 Trash Collection & Disposal Fees $1,200.00 $1,200.00 Water Charges $40,912.00 $40,912.00 City Staff Services $15,920.00 $18,627.00 Contractual Services $80,000.00 $84,701.00 Material to maintain structures, grounds $2,603.00 $2,828.00 Professional Services $66.00 $70.00 Required Backflow Inspection Estimate $234.00 $234.00 Total Direct Costs $142,319.00 $149,956.00 Capital Improvement Projects Project: Revegetation of landscape areas $10,000.00 $10,000.00 Total Capital Improvement Costs $10,000.00 $10,000.00 Indirect Costs Administration Costs $10,545.00 $7,838.00 Assessment Engineer $2,278.00 $2,536.00 Auditor Controller $4.60 $4.60 Total Indirect Costs $12,827.60 $10,378.60 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$4,030.80 $6,049.76 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $169,177.40 $176,384.36 Equivalent Dwelling Units (EDUs)(1)2,599.79 2,599.79 Rate per EDU $65.07 $67.85 Max Rate per EDU $65.07 $67.85 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $155,146.60 $160,334.60 Total Capital Improvement Costs $10,000.00 $10,000.00 Total Assessment $169,176.82 $176,384.36 Surplus / (Deficit)$4,030.22 $6,049.76 Reserve Account Activity Operating Reserves Beginning Balance(2)$80,058.58 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $80,058.58 Capital Improvement Beginning Balance(2)$166,107.61 Capital Improvement Replenishment $6,049.76 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $172,157.37 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 199 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 5 SPA I Phases 2 Direct Costs FY 2022-23 FY 2023-24 Utility Charges $3,236.00 $3,236.00 Trash Collection & Disposal Fees $5,000.00 $5,000.00 Water Charges $210,000.00 $210,000.00 City Staff Services $64,599.00 $70,104.00 Contractual Services $490,114.00 $514,301.00 Landscape Supplies $2,500.00 $2,500.00 Material to maintain structures, grounds $5,500.00 $6,804.00 Professional Services $429.00 $451.00 Wireless and Data Access Charges $0.00 $132.00 Required Backflow Inspection Estimate $1,170.00 $1,170.00 Total Direct Costs $782,548.00 $813,698.00 Capital Improvement Projects Project: Post and rail fencing/Wall repairs $20,000.00 $20,000.00 Total Capital Improvement Costs $20,000.00 $20,000.00 Indirect Costs Administration Costs $34,902.00 $29,397.00 Assessment Engineer $11,350.00 $12,640.00 Auditor Controller $159.70 $159.70 Total Indirect Costs $46,411.70 $42,196.70 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$4,750.36 $14,183.41 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $853,710.06 $890,078.11 Equivalent Dwelling Units (EDUs)(1)1,795.00 1,795.00 Rate per EDU $475.60 $495.87 Max Rate per EDU $475.60 $495.87 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $828,959.70 $855,894.70 Total Capital Improvement Costs $20,000.00 $20,000.00 Total Assessment $853,703.28 $890,078.11 Surplus / (Deficit)$4,743.58 $14,183.41 Reserve Account Activity Operating Reserves Beginning Balance(2)$427,423.72 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $427,423.72 Capital Improvement Beginning Balance(2)$171,463.75 Capital Improvement Replenishment $14,183.41 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $185,647.16 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 200 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 6 SPA 2 Direct Costs FY 2022-23 FY 2023-24 Utility Charges $648.00 $648.00 Trash Collection & Disposal Fees $1,800.00 $1,800.00 Water Charges $40,000.00 $40,000.00 City Staff Services $16,192.00 $15,743.00 Contractual Services $126,585.00 $132,914.00 Material to maintain structures, grounds $1,600.00 $1,688.00 Professional Services $75.00 $79.00 Total Direct Costs $186,900.00 $192,872.00 Capital Improvement Projects Project: Post and rail fencing/Wall repairs $10,000.00 $10,000.00 Project: Vegetation Management $0.00 $10,000.00 Total Capital Improvement Costs $10,000.00 $20,000.00 Indirect Costs Administration Costs $9,716.00 $10,165.00 Assessment Engineer $2,845.00 $3,168.00 Auditor Controller $57.00 $57.00 Total Indirect Costs $12,618.00 $13,390.00 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($56.20) ($7,877.13) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $209,461.80 $218,384.87 Equivalent Dwelling Units (EDUs)(1)573.20 573.20 Rate per EDU $365.43 $380.99 Max Rate per EDU $365.43 $380.99 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $199,518.00 $206,262.00 Total Capital Improvement Costs $10,000.00 $20,000.00 Total Assessment $209,458.74 $218,384.87 Surplus / (Deficit) ($59.26) ($7,877.13) Reserve Account Activity Operating Reserves Beginning Balance(2)$102,996.09 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $102,996.09 Capital Improvement Beginning Balance(2)$339,472.08 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($7,877.13) Capital Improvement Ending Balance $331,594.95 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 201 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 7 SPA 3 Direct Costs FY 2022-23 FY 2023-24 Utility Charges $2,289.00 $2,289.00 Water Charges $85,075.00 $84,000.00 City Staff Services $19,215.00 $20,520.00 Contractual Services $193,451.00 $203,124.00 Material to maintain structures, grounds $1,614.00 $2,583.00 Professional Services $158.00 $167.00 Required Backflow Inspection Estimate $312.00 $312.00 Total Direct Costs $302,114.00 $312,995.00 Capital Improvement Projects Project: Post and rail fencing/Wall repairs $3,000.00 $0.00 Total Capital Improvement Costs $3,000.00 $0.00 Indirect Costs Administration Costs $13,209.00 $12,773.00 Assessment Engineer $3,412.00 $3,799.00 Auditor Controller $121.70 $121.70 Total Indirect Costs $16,742.70 $16,693.70 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($58,222.12) ($54,823.29) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $260,634.58 $274,865.41 Equivalent Dwelling Units (EDUs)(1)1,168.79 1,168.79 Rate per EDU $225.56 $235.17 Max Rate per EDU $225.56 $235.17 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $318,856.70 $329,688.70 Total Capital Improvement Costs $3,000.00 $0.00 Total Assessment $263,629.42 $274,865.41 Surplus / (Deficit) ($58,227.28) ($54,823.29) Reserve Account Activity Operating Reserves Beginning Balance(2)$164,683.77 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $164,683.77 Capital Improvement Beginning Balance(2)$122,729.47 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($54,823.29) Capital Improvement Ending Balance $67,906.18 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 202 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 8 Desilting Basin at Glen Abbey Direct Costs FY 2022-23 FY 2023-24 City Staff Services $1,583.00 $1,620.00 Contractual Services $0.00 $0.00 Storm Maintenance $3,000.00 $3,300.00 Total Direct Costs $4,583.00 $4,920.00 Capital Improvement Projects Project: Drainage structure repairs $25,000.00 $25,000.00 Total Capital Improvement Costs $25,000.00 $25,000.00 Indirect Costs Administration Costs $3,441.00 $3,452.00 Assessment Engineer $294.00 $326.00 Auditor Controller $15.50 $15.50 Total Indirect Costs $3,750.50 $3,793.50 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($27,155.82) ($27,272.65) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $6,177.68 $6,440.85 Equivalent Dwelling Units (EDUs)(1)118.82 118.82 Rate per EDU $51.99 $54.21 Max Rate per EDU $51.99 $54.21 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $8,333.50 $8,713.50 Total Capital Improvement Costs $25,000.00 $25,000.00 Total Assessment $6,175.54 $6,440.85 Surplus / (Deficit) ($27,157.96) ($27,272.65) Reserve Account Activity Operating Reserves Beginning Balance(2)$4,338.66 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $4,338.66 Capital Improvement Beginning Balance(2)$145,689.33 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($27,272.65) Capital Improvement Ending Balance $118,416.68 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 203 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 20 Zn 9 Telegraph Canyon Channel SPA 3 Direct Costs FY 2022-23 FY 2023-24 City Staff Services $317.00 $442.00 Contractual Services $0.00 $0.00 Storm Maintenance $600.00 $660.00 Total Direct Costs $917.00 $1,102.00 Capital Improvement Projects Project: Telegraph Canyon Channel maintenance $10,000.00 $0.00 Total Capital Improvement Costs $10,000.00 $0.00 Indirect Costs Administration Costs $3,220.00 $3,095.00 Assessment Engineer $294.00 $326.00 Auditor Controller $37.80 $37.80 Total Indirect Costs $3,551.80 $3,458.80 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($12,404.20) ($2,408.25) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $2,064.60 $2,152.55 Equivalent Dwelling Units (EDUs)(1)50.01 50.01 Rate per EDU $41.28 $43.04 Max Rate per EDU $41.28 $43.04 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $4,468.80 $4,560.80 Total Capital Improvement Costs $10,000.00 $0.00 Total Assessment $2,060.04 $2,152.55 Surplus / (Deficit) ($12,408.76) ($2,408.25) Reserve Account Activity Operating Reserves Beginning Balance(2)$2,262.31 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $2,262.31 Capital Improvement Beginning Balance(2)$63,811.03 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($2,408.25) Capital Improvement Ending Balance $61,402.78 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 204 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 23 Otay Rio Business Park Direct Costs FY 2022-23 FY 2023-24 Utility Charges $613.00 $613.00 Water Charges $8,751.00 $8,751.00 City Staff Services $4,668.00 $4,659.00 Contractual Services $38,730.00 $40,667.00 Material to maintain structures, grounds $1,506.00 $1,506.00 Required Backflow Inspection Estimate $156.00 $156.00 Total Direct Costs $54,424.00 $56,352.00 Capital Improvement Projects Project: Revegetation of landscape areas $10,000.00 $0.00 Project: Vegetation Management $0.00 $5,000.00 Total Capital Improvement Costs $10,000.00 $5,000.00 Indirect Costs Administration Costs $4,943.00 $4,952.00 Assessment Engineer $577.00 $642.00 Auditor Controller $0.90 $0.90 Total Indirect Costs $5,520.90 $5,594.90 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($11,152.69) ($5,650.14) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $58,792.21 $61,296.76 Equivalent Dwelling Units (EDUs)(1)114.98 114.98 Rate per EDU $511.33 $533.11 Max Rate per EDU $579.06 $603.73 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $59,944.90 $61,946.90 Total Capital Improvement Costs $10,000.00 $5,000.00 Total Assessment $58,792.12 $61,296.76 Surplus / (Deficit) ($11,152.78) ($5,650.14) Reserve Account Activity Operating Reserves Beginning Balance(2)$30,942.27 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $30,942.27 Capital Improvement Beginning Balance(2)$68,678.55 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($5,650.14) Capital Improvement Ending Balance $63,028.40 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 205 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 24 Canyon View Homes Direct Costs FY 2022-23 FY 2023-24 Utility Charges $313.00 $313.00 Water Charges $13,500.00 $13,500.00 City Staff Services $1,657.00 $1,970.00 Contractual Services (1)$7,304.00 $13,670.00 Material to maintain structures, grounds $82.00 $82.00 Required Backflow Inspection Estimate $234.00 $234.00 Total Direct Costs $23,090.00 $29,769.00 Indirect Costs Administration Costs $3,822.00 $4,023.00 Assessment Engineer $577.00 $642.00 Auditor Controller $4.00 $4.00 Total Indirect Costs $4,403.00 $4,669.00 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$7,215.80 $1,750.00 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $34,708.80 $36,188.00 Equivalent Dwelling Units (EDUs)(2)40.00 40.00 Rate per EDU $867.72 $904.70 Max Rate per EDU $867.74 $904.70 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $27,493.00 $34,438.00 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $34,708.80 $36,188.00 Surplus / (Deficit)$7,215.80 $1,750.00 Reserve Account Activity Operating Reserves Beginning Balance(3)$17,187.82 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $17,187.82 Capital Improvement Beginning Balance(3)$8,796.13 Capital Improvement Replenishment $1,750.00 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $10,546.13 (1) Includes capital improvements involving tree trimming. (2) EDUs have been projected based upon Fiscal Year 2022-23 information. (3) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 206 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 26 Park Bonita Direct Costs FY 2022-23 FY 2023-24 Utility Charges $154.00 $154.00 Water Charges $4,280.00 $2,500.00 City Staff Services $589.00 $673.00 Contractual Services $3,528.00 $3,705.00 Professional Services $19.00 $20.00 Required Backflow Inspection Estimate $78.00 $78.00 Total Direct Costs $8,648.00 $7,130.00 Capital Improvement Projects Project: Vegetation Management $0.00 $2,400.00 Total Capital Improvement Costs $0.00 $2,400.00 Indirect Costs Administration Costs $3,363.00 $3,186.00 Assessment Engineer $294.00 $326.00 Auditor Controller $1.90 $1.90 Total Indirect Costs $3,658.90 $3,513.90 Levy Breakdown Operating Reserve Replenishment/(Contribution)$632.86 $446.86 Capital Improvement Replenishment/(Contribution)$0.00 $0.00 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $12,939.76 $11,090.76 Equivalent Dwelling Units (EDUs)(1)19.00 19.00 Rate per EDU $681.04 $710.04 Max Rate per EDU $681.04 $710.06 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $12,306.90 $10,643.90 Total Capital Improvement Costs $0.00 $2,400.00 Total Assessment $12,939.76 $13,490.76 Surplus / (Deficit)$632.86 $446.86 Reserve Account Activity Operating Reserves Beginning Balance(2)$2,186.07 Operating Reserves Replenishment $446.86 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $2,632.93 Capital Improvement Beginning Balance(2)$0.00 Capital Improvement Replenishment $0.00 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $0.00 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 207 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OSD 31 Telegraph Canyon Estates Direct Costs FY 2022-23 FY 2023-24 Utility Charges $5,401.00 $5,873.00 Trash Collection & Disposal Fees $2,650.00 $2,650.00 Water Charges $41,146.00 $40,000.00 City Staff Services $14,406.00 $14,035.00 Contractual Services $92,880.00 $100,385.00 Landscape Supplies $1,500.00 $1,500.00 Material to maintain structures, grounds $3,500.00 $3,500.00 Professional Services $59.00 $62.00 Required Backflow Inspection Estimate $156.00 $156.00 Total Direct Costs $161,698.00 $168,161.00 Capital Improvement Projects Project: Revegetation of landscape areas $14,000.00 $0.00 Project: Post and rail fencing/Wall repairs $10,000.00 $9,000.00 Project: Vegetation Management $7,200.00 $17,000.00 Project: Irrigation Upgrades/Repairs $0.00 $2,500.00 Project: Lighting Repairs $10,000.00 $15,000.00 Total Capital Improvement Costs $41,200.00 $43,500.00 Indirect Costs Administration Costs $9,350.00 $9,721.00 Assessment Engineer $2,845.00 $3,168.00 Auditor Controller $34.40 $34.40 Total Indirect Costs $12,229.40 $12,923.40 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($15,607.40) ($25,064.40) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $199,520.00 $199,520.00 Equivalent Dwelling Units (EDUs)(1)344.00 344.00 Rate per EDU $580.00 $580.00 Max Rate per EDU $703.52 $733.49 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $173,927.40 $181,084.40 Total Capital Improvement Costs $41,200.00 $43,500.00 Total Assessment $199,520.00 $199,520.00 Surplus / (Deficit) ($15,607.40) ($25,064.40) Reserve Account Activity Operating Reserves Beginning Balance(2)$90,407.29 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $90,407.29 Capital Improvement Beginning Balance(2)$352,961.21 Capital Improvement Replenishment $0.00 Capital Improvement Contribution(3)($25,064.40) Capital Improvement Ending Balance $327,896.81 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 208 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Eastlake A Direct Costs FY 2022-23 FY 2023-24 Utility Charges $3,257.00 $3,257.00 Water Charges $40,388.00 $40,805.00 City Staff Services $9,010.00 $8,954.00 Contractual Services $66,524.00 $64,823.00 Material to maintain structures, grounds $3,267.00 $3,267.00 Professional Services $40.00 $42.00 Wireless and Data Access Charges $603.00 $631.00 Required Backflow Inspection Estimate $702.00 $702.00 Total Direct Costs $123,791.00 $122,481.00 Capital Improvement Projects Project: Revegetation of landscape areas $7,000.00 $7,000.00 Total Capital Improvement Costs $7,000.00 $7,000.00 Indirect Costs Administration Costs $7,085.00 $7,141.00 Assessment Engineer $1,995.00 $2,221.00 Auditor Controller $242.70 $242.70 Total Indirect Costs $9,322.70 $9,604.70 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($21,991.10) ($15,004.64) Otay Lakes Rd Collectible $21,747.39 $21,747.39 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $139,869.99 $145,828.45 Equivalent Dwelling Units (EDUs)(1)8,698.96 8,698.96 Otay Lakes Rd Collectible / EDU $2.50 $2.50 Rate per EDU $16.08 $16.76 Max Rate per EDU $16.08 $16.76 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $154,861.09 $153,833.09 Total Capital Improvement Costs $7,000.00 $7,000.00 Total Assessment $139,841.82 $145,828.45 Surplus / (Deficit) ($22,019.27) ($15,004.64) Reserve Account Activity Operating Reserves Beginning Balance(2)$76,820.41 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $76,820.41 Capital Improvement Beginning Balance(2)$62,764.86 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($15,004.64) Capital Improvement Ending Balance $47,760.22 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 209 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Eastlake B Direct Costs FY 2022-23 FY 2023-24 Water Charges $23,549.00 $23,549.00 City Staff Services $6,314.00 $6,885.00 Contractual Services $58,511.00 $61,437.00 Material to maintain structures, grounds $1,000.00 $1,000.00 Professional Services $11.00 $12.00 Total Direct Costs $89,385.00 $92,883.00 Capital Improvement Projects Project: Revegetation of landscape areas $8,000.00 $15,000.00 Total Capital Improvement Costs $8,000.00 $15,000.00 Indirect Costs Administration Costs $6,183.00 $6,369.00 Assessment Engineer $1,144.00 $1,273.00 Auditor Controller $236.70 $236.70 Total Indirect Costs $7,563.70 $7,878.70 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($24,479.76) ($31,505.33) Otay Lakes Rd Collectible $8,437.95 $8,437.95 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $88,906.89 $92,694.32 Equivalent Dwelling Units (EDUs)(1)3,375.18 3,375.18 Otay Lakes Rd Collectible / EDU $2.50 $2.50 Rate per EDU $26.34 $27.46 Max Rate per EDU $26.34 $27.46 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $105,386.65 $109,199.65 Total Capital Improvement Costs $8,000.00 $15,000.00 Total Assessment $88,898.02 $92,694.32 Surplus / (Deficit) ($24,488.63) ($31,505.33) Reserve Account Activity Operating Reserves Beginning Balance(2)$54,542.97 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $54,542.97 Capital Improvement Beginning Balance(2)$120,232.44 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($31,505.33) Capital Improvement Ending Balance $88,727.11 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 210 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Eastlake C Direct Costs FY 2022-23 FY 2023-24(1) Utility Charges $0.00 $500.00 Water Charges $0.00 $12,000.00 City Staff Services $0.00 $3,434.00 Contractual Services $0.00 $26,100.00 Material to maintain structures, grounds $0.00 $2,000.00 Total Direct Costs $0.00 $44,034.00 Capital Improvement Projects Project: Irrigation Upgrades/Repairs $0.00 $5,000.00 Total Capital Improvement Costs $0.00 $5,000.00 Indirect Costs Administration Costs $7,575.00 $4,866.00 Assessment Engineer $294.00 $326.00 Auditor Controller $0.40 $0.40 Total Indirect Costs $7,869.40 $5,192.40 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($28.77) ($23,439.46) Otay Lakes Rd Collectible $23,439.06 $23,439.06 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $31,279.69 $49,226.00 Equivalent Dwelling Units (EDUs)(2)9,375.63 9,375.63 Otay Lakes Rd Collectible / EDU $2.50 $2.50 Rate per EDU $3.34 $5.78 Max Rate per EDU $218.13 $227.42 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $31,308.46 $72,665.46 Total Capital Improvement Costs $0.00 $5,000.00 Total Assessment $31,279.64 $54,226.00 Surplus / (Deficit) ($28.82) ($23,439.46) Reserve Account Activity Operating Reserves Beginning Balance (3)$36,314.64 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $36,314.64 Capital Improvement Beginning Balance (3)$167,089.88 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($23,439.46) Capital Improvement Ending Balance $143,650.42 (2) EDUs have been projected based upon Fiscal Year 2022-23 information. (3) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 (1) Maintenance was previously provided by the US Olympic Committee. The District took over maintenance of the facilities starting in August 2022. The FY 2023-24 assessment reflects the new maintenance costs associated, which financially impacts only the city. Page 211 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Eastlake D Direct Costs FY 2022-23 FY 2023-24 Water Charges $29,481.00 $29,481.00 City Staff Services $10,463.00 $12,946.00 Contractual Services $58,468.00 $61,392.00 Material to maintain structures, grounds $473.00 $526.00 Professional Services $66.00 $70.00 Wireless and Data Access Charges $483.00 $508.00 Required Backflow Inspection Estimate $78.00 $78.00 Total Direct Costs $99,512.00 $105,001.00 Capital Improvement Projects Project: Post and rail fencing/Wall repairs $0.00 $0.00 Total Capital Improvement Costs $0.00 $0.00 Indirect Costs Administration Costs $8,635.00 $6,152.00 Assessment Engineer $1,711.00 $1,905.00 Auditor Controller $52.30 $52.30 Total Indirect Costs $10,398.30 $8,109.30 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$12,324.27 $14,376.60 Otay Lakes Rd Collectible $1,059.50 $1,059.50 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $123,294.07 $128,546.40 Equivalent Dwelling Units (EDUs)(1)423.80 423.80 Otay Lakes Rd Collectible / EDU $2.50 $2.50 Rate per EDU $290.93 $303.32 Max Rate per EDU $290.93 $303.32 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $110,969.80 $114,169.80 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $123,291.08 $128,546.40 Surplus / (Deficit)$12,321.28 $14,376.60 Reserve Account Activity Operating Reserves Beginning Balance(2)$57,001.86 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $57,001.86 Capital Improvement Beginning Balance(2)$47,983.89 Capital Improvement Replenishment $14,376.60 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $62,360.49 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 212 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Eastlake E Direct Costs FY 2022-23 FY 2023-24 City Staff Services $3,430.00 $3,509.00 Contractual Services $0.00 $0.00 Storm Maintenance $6,500.00 $7,150.00 Total Direct Costs $9,930.00 $10,659.00 Capital Improvement Projects Project: Telegraph Canyon Channel maintenance $60,000.00 $0.00 Total Capital Improvement Costs $60,000.00 $0.00 Indirect Costs Administration Costs $3,505.00 $3,426.00 Assessment Engineer $294.00 $326.00 Auditor Controller $65.40 $65.40 Total Indirect Costs $3,864.40 $3,817.40 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution) ($60,433.80) ($1,115.80) Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $13,360.60 $13,360.60 Equivalent Dwelling Units (EDUs)(1)668.03 668.03 Rate per EDU $20.00 $20.00 Max Rate per EDU $41.47 $43.24 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $13,794.40 $14,476.40 Total Capital Improvement Costs $60,000.00 $0.00 Total Assessment $13,360.60 $13,360.60 Surplus / (Deficit) ($60,433.80) ($1,115.80) Reserve Account Activity Operating Reserves Beginning Balance(2)$7,220.11 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $7,220.11 Capital Improvement Beginning Balance(2)$152,322.84 Capital Improvement Replenishment $0.00 Capital Improvement Contribution ($1,115.80) Capital Improvement Ending Balance $151,207.04 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 213 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Bay Blvd Direct Costs FY 2022-23 FY 2023-24 Water Charges $5,058.00 $5,058.00 Contractual Services $0.00 $0.00 Landscape Supplies $0.00 $0.00 Material to maintain structures, grounds $0.00 $0.00 Total Direct Costs $5,058.00 $5,058.00 Indirect Costs Administration Costs $4,176.00 $4,176.00 Assessment Engineer $294.00 $326.00 Auditor Controller $0.40 $0.40 Total Indirect Costs $4,470.40 $4,502.40 Levy Breakdown Operating Reserve Replenishment/(Contribution)$0.00 $0.00 Capital Improvement Replenishment/(Contribution)$3,221.57 $3,189.57 Contribution Due to Shortfall $0.00 $0.00 Balance to Levy $12,749.97 $12,749.97 Equivalent Dwelling Units (EDUs)(1)6.39 6.39 Rate per EDU $1,995.30 $1,995.30 Max Rate per EDU $3,753.27 $3,913.16 Percent Change from Prior year Max Rate 0.79% 4.26% Total Annual Costs $9,528.40 $9,560.40 Total Capital Improvement Costs $0.00 $0.00 Total Assessment $12,749.92 $12,749.97 Surplus / (Deficit)$3,221.52 $3,189.57 Reserve Account Activity Operating Reserves Beginning Balance(2)$4,762.11 Operating Reserves Replenishment $0.00 Operating Reserves Contribution $0.00 Operating Reserves Ending Balance $4,762.11 Capital Improvement Beginning Balance(2)$51,441.32 Capital Improvement Replenishment $3,189.57 Capital Improvement Contribution $0.00 Capital Improvement Ending Balance $54,630.89 (1) EDUs have been projected based upon Fiscal Year 2022-23 information. (2) The estimated June 30, 2023 fund balance was projected based upon fund balance as of June 30, 2022. Estimated through June 30 Page 214 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda APPENDIX D Assessment Rolls Page 215 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-02 - OSD 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6420501600 $422.64 6420502600 $210.56 6420502700 $151.48 6420502800 $911.96 6422510100 $151.48 6422510200 $151.48 6422510300 $151.48 6422510400 $151.48 6422510500 $151.48 6422510600 $151.48 6422510700 $151.48 6422510800 $151.48 6422510900 $151.48 6422511000 $151.48 6422511100 $151.48 6422511200 $151.48 6422511300 $151.48 6422511400 $151.48 6422511500 $151.48 6422511600 $151.48 6422511700 $151.48 6422511800 $151.48 6422511900 $151.48 6422512000 $151.48 6422512100 $151.48 6422512200 $151.48 6422512300 $151.48 6422512400 $151.48 6422512500 $151.48 6422512600 $151.48 6422512700 $151.48 6422512800 $151.48 6422512900 $151.48 6422513000 $151.48 6422513100 $151.48 6422513200 $151.48 6422520100 $151.48 6422520200 $151.48 6422520300 $151.48 6422520400 $151.48 6422520500 $151.48 6422520600 $151.48 6422520700 $151.48 6422520800 $151.48 6422520900 $151.48 6422521000 $151.48 6422521100 $151.48 6422521200 $151.48 6422521300 $151.48 6422521400 $151.48 6422521500 $151.48 6422521600 $151.48 6422521700 $151.48 6422521800 $151.48 6422521900 $151.48 6422522000 $151.48 6422530100 $151.48 6422530200 $151.48 6422530300 $151.48 6422530400 $151.48 6422530500 $151.48 6422530600 $151.48 6422530700 $151.48 6422530800 $151.48 6422530900 $151.48 6422531000 $151.48 6422531100 $151.48 6422531200 $151.48 6422531300 $151.48 6422531400 $151.48 6422531500 $151.48 6422531600 $151.48 6422531700 $151.48 6422531800 $151.48 6422531900 $151.48 6422532000 $151.48 6422532100 $151.48 6422532200 $151.48 6422532300 $151.48 6422532400 $151.48 6422532500 $151.48 6422532600 $151.48 6422532700 $151.48 6422532800 $151.48 6422532900 $151.48 6422533000 $151.48 6422533100 $151.48 6422533200 $151.48 6422533300 $151.48 6422533400 $151.48 6422533500 $151.48 6422533600 $151.48 6422533700 $151.48 6422533800 $151.48 6422533900 $151.48 6422534000 $151.48 6422534100 $151.48 6422534200 $151.48 6422534300 $151.48 6422534400 $151.48 6422610100 $151.48 6422610200 $151.48 6422610300 $151.48 6422610400 $151.48 6422610500 $151.48 6422610600 $151.48 6422610700 $151.48 6422610800 $151.48 6422610900 $151.48 6422611000 $151.48 6422611100 $151.48 6422611200 $151.48 6422611300 $151.48 6422611400 $151.48 6422611500 $151.48 6422611600 $151.48 6422611700 $151.48 6422620100 $151.48 6422620200 $151.48 6422620300 $151.48 6422620400 $151.48 6422620500 $151.48 6422620600 $151.48 6422620700 $151.48 6422620800 $151.48 6422620900 $151.48 6422621000 $151.48 6422621100 $151.48 6422621200 $151.48 6422621300 $151.48 6422621400 $151.48 6422621500 $151.48 6422621600 $151.48 6422621700 $151.48 6422621800 $151.48 6422621900 $151.48 6422622000 $151.48 6422622100 $151.48 6422622200 $151.48 6422622300 $151.48 6422622400 $151.48 Assessment Roll Page 1 of 189 City of Chula Vista Engineer's ReportPage 216 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-02 - OSD 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6422622500 $151.48 6422622600 $151.48 6422622700 $151.48 6422622800 $151.48 6422622900 $151.48 6422623000 $151.48 6422623100 $151.48 6422623200 $151.48 6422623300 $151.48 6422623400 $151.48 6422623500 $151.48 6422623600 $151.48 6422710100 $151.48 6422710200 $151.48 6422710300 $151.48 6422710400 $151.48 6422710500 $151.48 6422710600 $151.48 6422710700 $151.48 6422710800 $151.48 6422710900 $151.48 6422711000 $151.48 6422711100 $151.48 6422711200 $151.48 6422711300 $151.48 6422711400 $151.48 6422711500 $151.48 6422711600 $151.48 6422711700 $151.48 6422711800 $151.48 6422711900 $151.48 6422712000 $151.48 6422712100 $151.48 6422712200 $151.48 6422712300 $151.48 6422712400 $151.48 6422712500 $151.48 6422712600 $151.48 6422712700 $151.48 6422712800 $151.48 6422712900 $151.48 6422713000 $151.48 6422713100 $151.48 6422713200 $151.48 6422713300 $151.48 6422713400 $151.48 6422713500 $151.48 6422713600 $151.48 6422713700 $151.48 6422713800 $151.48 6422720100 $151.48 6422720200 $151.48 6422720300 $151.48 6422720400 $151.48 6422720500 $151.48 6422720600 $151.48 6422720700 $151.48 6422720800 $151.48 6422720900 $151.48 6422721000 $151.48 6422721100 $151.48 6422721200 $151.48 6422721300 $151.48 6422721400 $151.48 6422721500 $151.48 6422721600 $151.48 6422721700 $151.48 6422721800 $151.48 6422721900 $151.48 6422722000 $151.48 6422722100 $151.48 6422722200 $151.48 6422722300 $151.48 6422722400 $151.48 6422722500 $151.48 6422722600 $151.48 6422722700 $151.48 6422722800 $151.48 6422722900 $151.48 6422723000 $151.48 6422723100 $151.48 6422723200 $151.48 6422723300 $151.48 6422723400 $151.48 6422723500 $151.48 6422723600 $151.48 6422723700 $151.48 6422723800 $151.48 6422723900 $151.48 6422724000 $151.48 6422724100 $151.48 6422724200 $151.48 6422724300 $151.48 6422724400 $151.48 6422724500 $151.48 6422724600 $151.48 6422724700 $151.48 6422724800 $151.48 6422724900 $151.48 6422725000 $151.48 6422725100 $151.48 6422725200 $151.48 6422725300 $151.48 6422910100 $151.48 6422910200 $151.48 6422910300 $151.48 6422910400 $151.48 6422910500 $151.48 6422910600 $151.48 6422910700 $151.48 6422910800 $151.48 6422910900 $151.48 6422911000 $151.48 6422911100 $151.48 6422911200 $151.48 6422911300 $151.48 6422911400 $151.48 6422911500 $151.48 6422911600 $151.48 6422911700 $151.48 6422911800 $151.48 6422911900 $151.48 6422912000 $151.48 6422912100 $151.48 6422912200 $151.48 6422912300 $151.48 6422912400 $151.48 6422912500 $151.48 6422912600 $151.48 6422912700 $151.48 6422912800 $151.48 6423040100 $151.48 6423040200 $151.48 6423040300 $151.48 6423040400 $151.48 6423040500 $151.48 6423040600 $151.48 6423040700 $151.48 6423040800 $151.48 6423040900 $151.48 6423041000 $151.48 Page 2 of 189 City of Chula Vista Engineer's ReportPage 217 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-02 - OSD 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423041100 $151.48 6423041200 $151.48 6423041300 $151.48 6423041400 $151.48 6423041500 $151.48 6423041600 $151.48 6423041700 $151.48 6423050100 $151.48 6423050200 $151.48 6423050300 $151.48 6423050400 $151.48 6423050500 $151.48 6423050600 $151.48 6423050700 $151.48 6423050800 $151.48 6423050900 $151.48 6423051000 $151.48 6423051100 $151.48 6423051200 $151.48 6423051300 $151.48 6423060100 $151.48 6423060200 $151.48 6423060300 $151.48 6423060400 $151.48 6423060500 $151.48 6423060600 $151.48 6423060700 $151.48 6423060800 $151.48 6423060900 $151.48 6423061000 $151.48 6423061100 $151.48 6423061200 $151.48 6423061300 $151.48 6423061400 $151.48 6423061500 $151.48 6423061600 $151.48 6423061700 $151.48 6423061800 $151.48 6423061900 $151.48 6423062000 $151.48 6423062100 $151.48 6423062200 $151.48 6423062300 $151.48 6423062400 $151.48 6423062500 $151.48 6423062600 $151.48 6423062700 $151.48 6423062800 $151.48 6423062900 $151.48 6423063000 $151.48 6423063100 $151.48 6423063200 $151.48 6423063300 $151.48 6423063400 $151.48 6423063500 $151.48 6423063600 $151.48 6423063700 $151.48 6423063800 $151.48 6423064000 $151.48 6423064100 $151.48 6423064200 $151.48 6423064300 $151.48 6423064400 $151.48 6423064500 $151.48 6423064600 $151.48 6423065000 $151.48 6423110100 $151.48 6423110200 $151.48 6423110300 $151.48 6423110400 $151.48 6423110500 $151.48 6423110600 $151.48 6423110700 $151.48 6423110800 $151.48 6423110900 $151.48 6423111000 $151.48 6423111100 $151.48 6423111200 $151.48 6423111300 $151.48 6423111400 $151.48 6423111500 $151.48 6423111600 $151.48 6423111700 $151.48 6423111800 $151.48 6423111900 $151.48 6423112000 $151.48 6423112100 $151.48 6423120100 $151.48 6423120200 $151.48 6423120300 $151.48 6423120400 $151.48 6423120500 $151.48 6423120600 $151.48 6423120700 $151.48 6423130100 $151.48 6423130200 $151.48 6423130300 $151.48 6423130400 $151.48 6423130500 $151.48 6423130600 $151.48 6423130700 $151.48 6423130800 $151.48 6423130900 $151.48 6423131000 $151.48 6423131100 $151.48 6423140100 $151.48 6423140200 $151.48 6423140300 $151.48 6423140400 $151.48 6423140500 $151.48 6423140600 $151.48 6423140700 $151.48 6423140800 $151.48 6423140900 $151.48 6423141000 $151.48 6423141100 $151.48 6423141200 $151.48 6423141300 $151.48 6423141400 $151.48 6423141500 $151.48 6423141600 $151.48 6423141700 $151.48 6423141800 $151.48 6423141900 $151.48 6423142000 $151.48 6423142100 $151.48 6423142200 $151.48 6423142300 $151.48 6423142400 $151.48 6423150100 $151.48 6423150200 $151.48 6423150300 $151.48 6423150400 $151.48 6423150500 $151.48 6423150600 $151.48 6423150700 $151.48 6423200100 $151.48 6423200200 $151.48 6423200300 $151.48 6423200400 $151.48 6423200500 $151.48 Page 3 of 189 City of Chula Vista Engineer's ReportPage 218 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-02 - OSD 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423200600 $151.48 6423200700 $151.48 6423200800 $151.48 6423200900 $151.48 6423201000 $151.48 6423201100 $151.48 6423201200 $151.48 6423201300 $151.48 6423201400 $151.48 6423201500 $151.48 6423201600 $151.48 6423201700 $151.48 6423201800 $151.48 6423201900 $151.48 6423202000 $151.48 6423202100 $151.48 6423202200 $151.48 6423202300 $151.48 6423202400 $151.48 6423202500 $151.48 6423202600 $151.48 6423202700 $151.48 6423202800 $151.48 6423202900 $151.48 6423203000 $151.48 6423203100 $151.48 6423203200 $151.48 6423203300 $151.48 6423203400 $151.48 6423203500 $151.48 6423203600 $151.48 6423203700 $151.48 6423203800 $151.48 6423203900 $151.48 6423204000 $151.48 6423204100 $151.48 6423204200 $151.48 6423204300 $151.48 6423204400 $151.48 6423204500 $151.48 6423204600 $151.48 6423204700 $151.48 6423204800 $151.48 6423204900 $151.48 6423205000 $151.48 6423205100 $151.48 6423205200 $151.48 6423205300 $151.48 6423205400 $151.48 6423205500 $151.48 6423300401 $151.48 6423300402 $151.48 6423300403 $151.48 6423300404 $151.48 6423300405 $151.48 6423300406 $151.48 6423300407 $151.48 6423300408 $151.48 6423300409 $151.48 6423300410 $151.48 6423300411 $151.48 6423300412 $151.48 6423300413 $151.48 6423300414 $151.48 6423300415 $151.48 6423300416 $151.48 6423300417 $151.48 6423300418 $151.48 6423300419 $151.48 6423300420 $151.48 6423300421 $151.48 6423300422 $151.48 6423300423 $151.48 6423300424 $151.48 6423300425 $151.48 6423300426 $151.48 6423300427 $151.48 6423300428 $151.48 6423300429 $151.48 6423300430 $151.48 6423300431 $151.48 6423300432 $151.48 6423300433 $151.48 6423300434 $151.48 6423300435 $151.48 6423300436 $151.48 6423300437 $151.48 6423300438 $151.48 6423410100 $151.48 6423410200 $151.48 6423410300 $151.48 6423410400 $151.48 6423410500 $151.48 6423410600 $151.48 6423410700 $151.48 6423410800 $151.48 6423410900 $151.48 6423411000 $151.48 6423411100 $151.48 6423411200 $151.48 6423411300 $151.48 6423411400 $151.48 6423411500 $151.48 6423411600 $151.48 6423411700 $151.48 6423411800 $151.48 6423411900 $151.48 6423412000 $151.48 6423412100 $151.48 6423412200 $151.48 6423412300 $151.48 6423412400 $151.48 6423412500 $151.48 6423412600 $151.48 6423412700 $151.48 6423412800 $151.48 6423412900 $151.48 6423413000 $151.48 6423413100 $151.48 6423413200 $151.48 6423413300 $151.48 6423413400 $151.48 6423413500 $151.48 6423413600 $151.48 6423420100 $151.48 6423420200 $151.48 6423420300 $151.48 6423420400 $151.48 6423420500 $151.48 6423420600 $151.48 6423420700 $151.48 6423420800 $151.48 6423420900 $151.48 6423421000 $151.48 6423421100 $151.48 6423421200 $151.48 6423421300 $151.48 6423421400 $151.48 6423421500 $151.48 6423421600 $151.48 6423421700 $151.48 Page 4 of 189 City of Chula Vista Engineer's ReportPage 219 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-02 - OSD 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423421800 $151.48 6423421900 $151.48 6423422000 $151.48 6423422100 $151.48 6423422200 $151.48 6423422300 $151.48 6423422400 $151.48 6423422500 $151.48 6423422600 $151.48 6423422700 $151.48 6423422800 $151.48 6423422900 $151.48 6423423000 $151.48 6423423100 $151.48 6423423200 $151.48 6423423300 $151.48 6423423400 $151.48 6423423500 $151.48 6423423600 $151.48 6423423700 $151.48 6423423800 $151.48 6423423900 $151.48 6423424000 $151.48 6423424100 $151.48 6423424200 $151.48 6423424300 $151.48 6423424400 $151.48 6423424500 $151.48 6423424600 $151.48 6423424700 $151.48 6424000100 $151.48 6424000200 $151.48 6424000300 $151.48 6424000400 $151.48 6424000500 $151.48 6424000600 $151.48 6424000700 $151.48 6424000800 $151.48 6424000900 $151.48 6424001000 $151.48 6424001100 $151.48 6424001200 $151.48 6424001300 $151.48 6424001400 $151.48 6424001500 $151.48 6424001600 $151.48 6424001700 $151.48 6424001800 $151.48 6424001900 $151.48 6424002000 $151.48 6424002100 $151.48 6424002200 $151.48 6424002300 $151.48 6424002400 $151.48 6424002500 $151.48 6424002600 $151.48 6424002700 $151.48 6424002800 $151.48 6424002900 $151.48 6424003000 $151.48 6424003100 $151.48 6424003200 $151.48 6424003300 $151.48 6424003400 $151.48 6424003500 $151.48 6424003600 $151.48 6424003700 $151.48 6424003800 $151.48 6424003900 $151.48 6424010200 $151.48 6424010300 $151.48 6424010400 $151.48 6424010500 $151.48 6424010600 $151.48 6424010900 $151.48 6424011000 $151.48 6424011100 $151.48 6424011200 $151.48 6424011300 $151.48 6424011400 $151.48 6424011500 $151.48 6424011700 $151.48 6424011900 $151.48 6424012000 $151.48 Totals Parcels 648 Levy $99,249.76 Page 5 of 189 City of Chula Vista Engineer's ReportPage 220 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-03 - OSD 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6240220100 $70.26 6240220200 $70.26 6240220300 $70.26 6240220400 $70.26 6240220500 $70.26 6240220600 $70.26 6240220700 $70.26 6240220800 $70.26 6240220900 $70.26 6240221000 $70.26 6240221100 $70.26 6240221200 $70.26 6240221300 $70.26 6240221400 $70.26 6243405000 $70.26 6243405100 $70.26 6243405200 $70.26 6243405300 $70.26 6243405400 $70.26 6243405500 $70.26 6243405600 $70.26 6243405700 $70.26 6243405800 $70.26 6243405900 $70.26 6243406000 $70.26 6243406100 $70.26 6243406200 $70.26 6243410100 $70.26 6243410200 $70.26 6243410300 $70.26 6243410400 $70.26 6243410500 $70.26 6243410600 $70.26 6243410700 $70.26 6243410800 $70.26 6243410900 $70.26 6243411000 $70.26 6243411100 $70.26 6243810100 $70.26 6243810200 $70.26 6243810300 $70.26 6243810400 $70.26 6243810500 $70.26 6243810600 $70.26 6243810700 $70.26 6243810800 $70.26 6243810900 $70.26 6243830100 $70.26 6243830200 $70.26 6243830300 $70.26 6243830400 $70.26 6243830500 $70.26 6243830600 $70.26 6243830700 $70.26 6243830800 $70.26 6243830900 $70.26 6243831000 $70.26 6243831100 $70.26 6243831200 $70.26 6243831300 $70.26 6243831400 $70.26 6243831500 $70.26 6243831600 $70.26 6243831700 $70.26 6243831800 $70.26 6243831900 $70.26 6243832000 $70.26 6243832100 $70.26 6243832200 $70.26 6243832300 $70.26 6243832600 $70.26 6243832700 $70.26 6243832800 $70.26 6243832900 $70.26 6243833300 $70.26 6243850100 $70.26 6243850200 $70.26 6243850300 $70.26 6243850400 $70.26 6243850500 $70.26 6243850600 $70.26 6243850700 $70.26 6243850800 $70.26 6243850900 $70.26 6243851000 $70.26 6243851100 $70.26 6243851200 $70.26 6243851300 $70.26 6243851400 $70.26 6243851500 $70.26 6243851600 $70.26 6243851700 $70.26 6243852000 $70.26 6243852100 $70.26 6243852200 $70.26 6243852300 $70.26 6243852400 $70.26 6243852500 $70.26 6243852600 $70.26 6243852700 $70.26 6243852800 $70.26 6243852900 $70.26 6243853000 $70.26 6243853100 $70.26 6243853200 $70.26 6243853300 $70.26 6243853400 $70.26 6243853500 $70.26 6243853600 $70.26 6243853700 $70.26 6243853800 $70.26 6243853900 $70.26 6243854000 $70.26 6243854100 $70.26 6243854200 $70.26 6243854300 $70.26 6243854400 $70.26 6243854500 $70.26 6243854600 $70.26 6243854700 $70.26 6243854800 $70.26 6243854900 $70.26 6243855000 $70.26 6243900100 $70.26 6243900200 $70.26 6243900300 $70.26 6243900400 $70.26 6243900500 $70.26 6243900600 $70.26 6243900700 $70.26 6243900800 $70.26 6243900900 $70.26 6243901000 $70.26 6243901100 $70.26 6243901200 $70.26 6243901300 $70.26 6243901400 $70.26 6243901500 $70.26 6243901600 $70.26 6243901700 $70.26 6243901800 $70.26 Assessment Roll Page 6 of 189 City of Chula Vista Engineer's ReportPage 221 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-03 - OSD 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6243901900 $70.26 6243902000 $70.26 6243902100 $70.26 6243902200 $70.26 6243902300 $70.26 6243902400 $70.26 6243902500 $70.26 6243902600 $70.26 6243902700 $70.26 6243902800 $70.26 6243902900 $70.26 6243903000 $70.26 6243903100 $70.26 6243903200 $70.26 6243903300 $70.26 6243903400 $70.26 6243903500 $70.26 6243903600 $70.26 6243903700 $70.26 6243903800 $70.26 6243920100 $70.26 6243920200 $70.26 6243920300 $70.26 6243920400 $70.26 6243930100 $70.26 6243930200 $70.26 6243930300 $70.26 6243930400 $70.26 6243930500 $70.26 6243930600 $70.26 6243930700 $70.26 6243930800 $70.26 6243930900 $70.26 6243931000 $70.26 6243931100 $70.26 6243931200 $70.26 6243931300 $70.26 6243931400 $70.26 6243931500 $70.26 6243931600 $70.26 6243940100 $70.26 6243940200 $70.26 6243940300 $70.26 6243940400 $70.26 6243940500 $70.26 6243940600 $70.26 6243940700 $70.26 6243940800 $70.26 6243940900 $70.26 6243941000 $70.26 6243941100 $70.26 6243941200 $70.26 6243941300 $70.26 6243941400 $70.26 6243941500 $70.26 6244010100 $70.26 6244010200 $70.26 6244010300 $70.26 6244010400 $70.26 6244010500 $70.26 6244010600 $70.26 6244010700 $70.26 6244010800 $70.26 6244010900 $70.26 6244011000 $70.26 6244011100 $70.26 6244011200 $70.26 6244011300 $70.26 6244011400 $70.26 6244011500 $70.26 6244011600 $70.26 6244011700 $70.26 6244011800 $70.26 6244011900 $70.26 6244012000 $70.26 6244012100 $70.26 6244012200 $70.26 6244012300 $70.26 6244012400 $70.26 6244012500 $70.26 6244012600 $70.26 6244012700 $70.26 6244012800 $70.26 6244020100 $70.26 6244020200 $70.26 6244020300 $70.26 6244020400 $70.26 6244020500 $70.26 6244020600 $70.26 6244020700 $70.26 6244020800 $70.26 6244020900 $70.26 6244021000 $70.26 6244021100 $70.26 6244021200 $70.26 6244021300 $70.26 6244021400 $70.26 6244021500 $70.26 6244021600 $70.26 6244021700 $70.26 6244021800 $70.26 6244021900 $70.26 6244022000 $70.26 6244022100 $70.26 6244030100 $70.26 6244030200 $70.26 6244030300 $70.26 Totals Parcels 248 Levy $17,424.48 Page 7 of 189 City of Chula Vista Engineer's ReportPage 222 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-04 - OSD 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5932610100 $481.16 5932610200 $481.16 5932610300 $481.16 5932610400 $481.16 5932610500 $481.16 5932610600 $481.16 5932610700 $481.16 5932610800 $481.16 5932610900 $481.16 5932611000 $481.16 5932611100 $481.16 5932611200 $481.16 5932611300 $481.16 5932611400 $481.16 5932611500 $481.16 5932611600 $481.16 5932611700 $481.16 5932611800 $481.16 5932611900 $481.16 5932612000 $481.16 5932612100 $481.16 5932612200 $481.16 5932612300 $481.16 5932612400 $481.16 5932612500 $481.16 5932612600 $481.16 5932612700 $481.16 5932612800 $481.16 5932612900 $481.16 5932613000 $481.16 5932613100 $481.16 5932620100 $481.16 5932620200 $481.16 5932620300 $481.16 5932620400 $481.16 5932620500 $481.16 5932620600 $481.16 5932620700 $481.16 5932620800 $481.16 5932620900 $481.16 5932621100 $481.16 5932621200 $481.16 5932621300 $481.16 5932621400 $481.16 5932621500 $481.16 5932621600 $481.16 5932621700 $481.16 5932621800 $481.16 5932621900 $481.16 5932622000 $481.16 5932622100 $481.16 5932622200 $481.16 5932622300 $481.16 5932622400 $481.16 5932622900 $481.16 5932710100 $481.16 5932710200 $481.16 5932710300 $481.16 5932710400 $481.16 5932710500 $481.16 5932710600 $481.16 5932710700 $481.16 5932710800 $481.16 5932710900 $481.16 5932711000 $481.16 5932711100 $481.16 5932711200 $481.16 5932711300 $481.16 5932711400 $481.16 5932711500 $481.16 5932711600 $481.16 5932711700 $481.16 5932711800 $481.16 5932711900 $481.16 5932712000 $481.16 5932712100 $481.16 5932712200 $481.16 5932712300 $481.16 5932712400 $481.16 5932712500 $481.16 5932712600 $481.16 5932712700 $481.16 5932712800 $481.16 5932712900 $481.16 5932713000 $481.16 5932713100 $481.16 5932713200 $481.16 5932713300 $481.16 5932713400 $481.16 5932713500 $481.16 5932713600 $481.16 5932713700 $481.16 5932713800 $481.16 5932714000 $481.16 5932714100 $481.16 5932714200 $481.16 5932714300 $481.16 5932714400 $481.16 5932714500 $481.16 5932714600 $481.16 5932714700 $481.16 5932714800 $481.16 5932714900 $481.16 5932715000 $481.16 5932715100 $481.16 5932715200 $481.16 5932720100 $481.16 5932720200 $481.16 5932720300 $481.16 5932720500 $481.16 5932720700 $481.16 5932720800 $481.16 5932720900 $481.16 5932721000 $481.16 5932721100 $481.16 5932721400 $481.16 5932721500 $481.16 5932721600 $481.16 5932721700 $481.16 5932721800 $481.16 5932722000 $481.16 5932722100 $481.16 5932722300 $481.16 5932722600 $481.16 5932722700 $481.16 5932723000 $481.16 5932723300 $481.16 Totals Parcels 127 Levy $61,107.32 Assessment Roll Page 8 of 189 City of Chula Vista Engineer's ReportPage 223 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-05 - OSD 4 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5932910100 $508.20 5932910200 $508.20 5932910300 $508.20 5932910400 $508.20 5932910500 $508.20 5932910600 $508.20 5932910700 $508.20 5932911100 $508.20 5932911200 $508.20 5932911300 $508.20 5932911400 $508.20 5932911500 $508.20 5932911600 $508.20 5932911700 $508.20 5932911800 $508.20 5932911900 $508.20 5932912200 $508.20 5932912500 $508.20 5932912600 $508.20 5932912700 $508.20 5932913200 $508.20 5932913300 $508.20 5932920100 $508.20 5932920200 $508.20 5932920300 $508.20 5932920400 $508.20 5932920500 $508.20 5932920600 $508.20 5932920700 $508.20 5932920800 $508.20 5932920900 $508.20 5932921000 $508.20 5932921100 $508.20 5932921200 $508.20 5932921300 $508.20 5932921400 $508.20 5932921500 $508.20 5932921600 $508.20 5932921700 $508.20 5932921800 $508.20 5932921900 $508.20 5932922000 $508.20 5932922100 $508.20 5932922200 $508.20 5932922300 $508.20 5932922400 $508.20 5932922500 $508.20 5932922600 $508.20 5932922700 $508.20 5932922800 $508.20 5932923000 $508.20 5932923100 $508.20 5932923200 $508.20 5932923300 $508.20 5932923400 $508.20 5932923500 $508.20 5932923600 $508.20 5932923700 $508.20 5932923800 $508.20 5932923900 $508.20 5932924000 $508.20 5932924300 $508.20 5933300100 $508.20 5933300200 $508.20 5933300300 $508.20 5933300400 $508.20 5933300500 $508.20 5933300600 $508.20 5933300700 $508.20 5933300800 $508.20 5933300900 $508.20 5933301000 $508.20 5933301100 $508.20 5933301200 $508.20 5933301300 $508.20 5933400100 $508.20 5933400200 $508.20 5933400300 $508.20 5933400400 $508.20 5933400500 $508.20 5933400600 $508.20 5933400700 $508.20 5933400800 $508.20 5933400900 $508.20 5933401000 $508.20 5933401100 $508.20 5933401200 $508.20 5933401300 $508.20 5933401400 $508.20 5933401500 $508.20 5933401600 $508.20 5933401700 $508.20 5933401800 $508.20 5933401900 $508.20 5933402000 $508.20 5933402100 $508.20 5933402200 $508.20 5942210100 $508.20 5942210200 $508.20 5942210300 $508.20 5942210400 $508.20 5942210500 $508.20 5942210600 $508.20 5942210700 $508.20 5942210800 $508.20 5942210900 $508.20 5942211000 $508.20 5942211100 $508.20 5942211200 $508.20 5942211300 $508.20 5942211400 $508.20 5942211500 $508.20 5942211600 $508.20 5942211700 $508.20 5942211900 $508.20 5942212000 $508.20 5942212100 $508.20 5942212200 $508.20 5942212400 $508.20 5942212500 $508.20 5942212700 $508.20 5942212800 $508.20 5942212900 $508.20 5942213000 $508.20 5942213100 $508.20 5942213200 $508.20 5942213300 $508.20 5942213700 $508.20 5942213800 $508.20 5942214300 $508.20 5942214400 $508.20 5942214500 $508.20 5942214600 $508.20 5942214700 $508.20 5942214800 $508.20 5942215800 $508.20 5942215900 $508.20 5942216000 $508.20 5942216100 $508.20 5942216200 $508.20 5942216300 $508.20 Assessment Roll Page 9 of 189 City of Chula Vista Engineer's ReportPage 224 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-05 - OSD 4 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5942216400 $508.20 5942216500 $508.20 5942216600 $508.20 5942220100 $508.20 5942220200 $508.20 5942220300 $508.20 5942220400 $508.20 5942220500 $508.20 5942220600 $508.20 5942220700 $508.20 5942220900 $508.20 5942221000 $508.20 5942221100 $508.20 5942221200 $508.20 5942221300 $508.20 5942221400 $508.20 5942221500 $508.20 5942221600 $508.20 5942221700 $508.20 5942221800 $508.20 5942221900 $508.20 5942222000 $508.20 5942222100 $508.20 5942222200 $508.20 5942222300 $508.20 5942222900 $508.20 5942223000 $508.20 5942223100 $508.20 5942800100 $508.20 5942800200 $508.20 5942800400 $508.20 5942800500 $508.20 5942800600 $508.20 5942800700 $508.20 5942800800 $508.20 5942800900 $508.20 5942801000 $508.20 5942801100 $508.20 5942801200 $508.20 5942801300 $508.20 5942801400 $508.20 5942801500 $508.20 5942801600 $508.20 5942801700 $508.20 5942801800 $508.20 5942801900 $508.20 5942802000 $508.20 5942802100 $508.20 5942802200 $508.20 5942802300 $508.20 5942802400 $508.20 5942802500 $508.20 5942802600 $508.20 5942802700 $508.20 5942802800 $508.20 5942802900 $508.20 5942803000 $508.20 5942803200 $508.20 5942803300 $508.20 5942803400 $508.20 5942803500 $508.20 5942803600 $508.20 5942803700 $508.20 5942803800 $508.20 5942803900 $508.20 5942804000 $508.20 5942804300 $508.20 Totals Parcels 208 Levy $105,705.60 Page 10 of 189 City of Chula Vista Engineer's ReportPage 225 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-06 - OSD 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6401010200 $495.58 6401010300 $495.58 6401010400 $495.58 6401010500 $495.58 6401010600 $495.58 6401010700 $495.58 6401010800 $495.58 6401010900 $495.58 6401011000 $495.58 6401011100 $495.58 6401011200 $495.58 6401011300 $495.58 6401011400 $495.58 6401011500 $495.58 6401011600 $495.58 6401011700 $495.58 6401011800 $495.58 6401011900 $495.58 6401012000 $495.58 6401012100 $495.58 6401012200 $495.58 6401012300 $495.58 6401012400 $495.58 6401012500 $495.58 6401020100 $495.58 6401020200 $495.58 6401020300 $495.58 6401020400 $495.58 6401020500 $495.58 6401020600 $495.58 6401020700 $495.58 6401020800 $495.58 6401020900 $495.58 6401021000 $495.58 6401021100 $495.58 6401021200 $495.58 6401021300 $495.58 6401021400 $495.58 6401021500 $495.58 6401021600 $495.58 6401021700 $495.58 6401021800 $495.58 6401021900 $495.58 6401022000 $495.58 6401030100 $495.58 6401030200 $495.58 6401030300 $495.58 6401030400 $495.58 6401030500 $495.58 6401030600 $495.58 6401030700 $495.58 6401030800 $495.58 6401030900 $495.58 6401031000 $495.58 6401031100 $495.58 6401031200 $495.58 6401031300 $495.58 6401031400 $495.58 6401040100 $495.58 6401040200 $495.58 6401040300 $495.58 6401040400 $495.58 6401040500 $495.58 6401040600 $495.58 6401040700 $495.58 6401040800 $495.58 6401040900 $495.58 6401041000 $495.58 6401041100 $495.58 6401041200 $495.58 6401100100 $495.58 6401100200 $495.58 6401100300 $495.58 6401100400 $495.58 6401100500 $495.58 6401100600 $495.58 6401100700 $495.58 6401100800 $495.58 6401100900 $495.58 6401101000 $495.58 6401101100 $495.58 6401101200 $495.58 6401101300 $495.58 6401101400 $495.58 6401101500 $495.58 6401101600 $495.58 6401101700 $495.58 6401101800 $495.58 6401101900 $495.58 6401102000 $495.58 6401102100 $495.58 6401102200 $495.58 6401102300 $495.58 6401102400 $495.58 6401102500 $495.58 6401102600 $495.58 6401102700 $495.58 6401102800 $495.58 6401102900 $495.58 6401103000 $495.58 6401103100 $495.58 6401103200 $495.58 6401103300 $495.58 6401103400 $495.58 6401103500 $495.58 6401103600 $495.58 6401103700 $495.58 6401103800 $495.58 6401103900 $495.58 6401104000 $495.58 6401104100 $495.58 6401104200 $495.58 6401104300 $495.58 6402111600 $495.58 6402111700 $495.58 6402111800 $495.58 6402111900 $495.58 6402112000 $495.58 6402112100 $495.58 6402112200 $495.58 6402112300 $495.58 6402112400 $495.58 Totals Parcels 122 Levy $60,460.76 Assessment Roll Page 11 of 189 City of Chula Vista Engineer's ReportPage 226 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-07 - OSD 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6397010100 $245.08 6397010200 $245.08 6397010300 $245.08 6397010400 $245.08 6397010500 $245.08 6397010600 $245.08 6397010700 $245.08 6397010800 $245.08 6397010900 $245.08 6397011000 $245.08 6397011100 $245.08 6397011200 $245.08 6397011300 $245.08 6397011400 $245.08 6397011500 $245.08 6397011600 $245.08 6397011700 $245.08 6397011800 $245.08 6397011900 $245.08 6397012000 $245.08 6397012100 $245.08 6397012200 $245.08 6397012300 $245.08 6397012400 $245.08 6397012500 $245.08 6397012600 $245.08 6397012700 $245.08 6397012800 $245.08 6397012900 $245.08 6397013000 $245.08 6397013100 $245.08 6397013200 $245.08 6397013300 $245.08 6397013400 $245.08 6397013500 $245.08 6397013600 $245.08 6397013700 $245.08 6397013800 $245.08 6397013900 $245.08 6397014000 $245.08 6397014100 $245.08 6397014200 $245.08 6397014300 $245.08 6397014400 $245.08 6397014500 $245.08 6397014600 $245.08 6397014700 $245.08 6397014800 $245.08 6397014900 $245.08 6397015000 $245.08 6397015100 $245.08 6397015200 $245.08 6397015300 $245.08 6397015400 $245.08 6397015500 $245.08 6397015600 $245.08 6397015700 $245.08 6397015800 $245.08 6397015900 $245.08 6397020100 $245.08 6397020200 $245.08 6397020300 $245.08 6397020400 $245.08 6397020500 $245.08 6397020600 $245.08 6397020700 $245.08 6397020800 $245.08 6397020900 $245.08 6397021000 $245.08 6397021100 $245.08 6397021200 $245.08 6397021300 $245.08 6397021400 $245.08 6397021500 $245.08 6397021600 $245.08 6397021700 $245.08 6397021800 $245.08 6397021900 $245.08 6397022000 $245.08 6397022100 $245.08 6397022200 $245.08 6397022300 $245.08 6397022400 $245.08 6397022500 $245.08 6397022600 $245.08 6397022700 $245.08 6397022800 $245.08 6397022900 $245.08 6397023000 $245.08 6397023100 $245.08 6397023200 $245.08 6397023300 $245.08 6397023400 $245.08 6397023500 $245.08 6397023600 $245.08 6397023700 $245.08 6397023800 $245.08 6397023900 $245.08 6397024000 $245.08 6397024100 $245.08 6397024200 $245.08 6397024300 $245.08 6397024400 $245.08 6397024500 $245.08 6397024600 $245.08 6397024700 $245.08 6397024800 $245.08 6397024900 $245.08 6397025000 $245.08 6397025100 $245.08 6397025200 $245.08 6397100100 $245.08 6397100200 $245.08 6397100300 $245.08 6397100400 $245.08 6397100500 $245.08 6397100600 $245.08 6397100700 $245.08 6397100800 $245.08 6397100900 $245.08 6397101000 $245.08 6397101100 $245.08 6397101200 $245.08 6397101300 $245.08 6397101400 $245.08 6397101500 $245.08 6397101600 $245.08 6397101700 $245.08 6397101800 $245.08 6397101900 $245.08 6397102000 $245.08 6397102100 $245.08 6397102200 $245.08 6397102300 $245.08 6397102400 $245.08 6397102500 $245.08 6397102600 $245.08 6397102700 $245.08 6397102800 $245.08 6397102900 $245.08 6397103000 $245.08 Assessment Roll Page 12 of 189 City of Chula Vista Engineer's ReportPage 227 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-07 - OSD 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6397103100 $245.08 6397103200 $245.08 6397103300 $245.08 6397103400 $245.08 6397103500 $245.08 6397103600 $245.08 6397103700 $245.08 6397103800 $245.08 6397103900 $245.08 6397104000 $245.08 6397104100 $245.08 6397104200 $245.08 6397104300 $245.08 6397104400 $245.08 6397104500 $245.08 6397104600 $245.08 6397104700 $245.08 6397104800 $245.08 6397104900 $245.08 6397105000 $245.08 6397105100 $245.08 Totals Parcels 162 Levy $39,702.96 Page 13 of 189 City of Chula Vista Engineer's ReportPage 228 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-08 - OSD 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6206510500 $171.18 6206510600 $171.18 6206510700 $171.18 6206510800 $171.18 6206510900 $171.18 6206511000 $171.18 6206511100 $171.18 6206511200 $171.18 6206511300 $171.18 6206511400 $171.18 6206511500 $171.18 6206511600 $171.18 6206511700 $171.18 6206511800 $171.18 6206511900 $171.18 6206512000 $171.18 6206512100 $171.18 6206512200 $171.18 6206512300 $171.18 6206512400 $171.18 6206512500 $171.18 6206512600 $171.18 6206512700 $171.18 6206512800 $171.18 6206512900 $171.18 6206513200 $171.18 6206520100 $171.18 6206520200 $171.18 6206520300 $171.18 6206520400 $171.18 6206520500 $171.18 6206520600 $171.18 6206520700 $171.18 6206521200 $171.18 6206521300 $171.18 6206521400 $171.18 6206521500 $171.18 6206521600 $171.18 6206521700 $171.18 6206521800 $171.18 6206521900 $171.18 6206522000 $171.18 6206522200 $171.18 6206522300 $171.18 6206522400 $171.18 6206522500 $171.18 6206522600 $171.18 6206522700 $171.18 6206522800 $171.18 6206522900 $171.18 6206523000 $171.18 6206523100 $171.18 6206523200 $171.18 6206523300 $171.18 6206523400 $171.18 6206523500 $171.18 6206523600 $171.18 6206523700 $171.18 6206523800 $171.18 6206523900 $171.18 6206524000 $171.18 6206524100 $171.18 6206524200 $171.18 6206524300 $171.18 6206524400 $171.18 6206524500 $171.18 6206524600 $171.18 6206524700 $171.18 6206524800 $171.18 6206524900 $171.18 6206525000 $171.18 6206525100 $171.18 6206600100 $171.18 6206600200 $171.18 6206600300 $171.18 6206600400 $171.18 6206600500 $171.18 6206600600 $171.18 6206600700 $171.18 6206600800 $171.18 6206600900 $171.18 6206601000 $171.18 6206601100 $171.18 6206601200 $171.18 6206601300 $171.18 6206601400 $171.18 6206601500 $171.18 6206601600 $171.18 6206601700 $171.18 6206601800 $171.18 6206602000 $171.18 6206602100 $171.18 6206602200 $171.18 6206602300 $171.18 6206602400 $171.18 6206602500 $171.18 6206602600 $171.18 6206602700 $171.18 6206602800 $171.18 6206602900 $171.18 Totals Parcels 100 Levy $17,118.00 Assessment Roll Page 14 of 189 City of Chula Vista Engineer's ReportPage 229 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-10 - OSD 8 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5933010100 $782.14 5933010200 $782.14 5933010300 $782.14 5933010400 $782.14 5933010500 $782.14 5933010600 $782.14 5933010700 $782.14 5933010800 $782.14 5933010900 $782.14 5933011000 $782.14 5933011100 $782.14 5933011200 $782.14 5933011300 $782.14 5933011400 $782.14 5933011500 $782.14 5933011600 $782.14 5933011900 $782.14 5933012000 $782.14 5933012100 $782.14 5933012200 $782.14 5933012300 $782.14 5933012400 $782.14 5933012500 $782.14 5933012700 $782.14 5933020100 $782.14 5933020200 $782.14 5933020300 $782.14 5933020400 $782.14 5933020500 $782.14 5933020800 $782.14 5933020900 $782.14 5933021000 $782.14 5933021100 $782.14 5933021200 $782.14 5933021300 $782.14 5933021400 $782.14 5933021500 $782.14 5933021600 $782.14 5933021700 $782.14 5933021800 $782.14 5933021900 $782.14 5933022000 $782.14 5933022100 $782.14 5933022200 $782.14 5933022300 $782.14 5933022400 $782.14 5933022500 $782.14 5933022600 $782.14 5933022700 $782.14 5933022800 $782.14 5933022900 $782.14 5933024000 $782.14 5933024200 $782.14 5933110100 $782.14 5933110200 $782.14 5933110300 $782.14 5933110400 $782.14 5933110500 $782.14 5933110600 $782.14 5933110700 $782.14 5933110800 $782.14 5933110900 $782.14 5933111000 $782.14 5933111100 $782.14 5933111200 $782.14 5933111300 $782.14 5933111400 $782.14 5933111500 $782.14 5933111600 $782.14 5933111700 $782.14 5933111800 $782.14 5933111900 $782.14 5933112000 $782.14 5933112100 $782.14 5933112200 $782.14 5933112300 $782.14 5933112400 $782.14 5933112500 $782.14 5933120100 $782.14 5933120200 $782.14 5933120300 $782.14 5933120400 $782.14 5933120500 $782.14 5933120600 $782.14 5933120700 $782.14 5933120800 $782.14 5933120900 $782.14 5933121000 $782.14 5933121100 $782.14 5933121200 $782.14 5933121300 $782.14 5933121400 $782.14 5933121500 $782.14 5933121600 $782.14 5933121700 $782.14 5933121800 $782.14 5933121900 $782.14 5933122000 $782.14 5933122100 $782.14 5933122200 $782.14 5933122300 $782.14 5933122400 $782.14 5933122500 $782.14 5933122600 $782.14 5933122700 $782.14 5933122800 $782.14 5933122900 $782.14 5933123000 $782.14 5933123100 $782.14 5933123200 $782.14 Totals Parcels 110 Levy $86,035.40 Assessment Roll Page 15 of 189 City of Chula Vista Engineer's ReportPage 230 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-11 - OSD 9 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6401410100 $221.64 6401410200 $221.64 6401410300 $221.64 6401410400 $221.64 6401410500 $221.64 6401410600 $221.64 6401410700 $221.64 6401410800 $221.64 6401410900 $221.64 6401411000 $221.64 6401411100 $221.64 6401411200 $221.64 6401411300 $221.64 6401411400 $221.64 6401411500 $221.64 6401411600 $221.64 6401411700 $221.64 6401411800 $221.64 6401411900 $221.64 6401412000 $221.64 6401412100 $221.64 6401412200 $221.64 6401412300 $221.64 6401412400 $221.64 6401420100 $221.64 6401420200 $221.64 6401420300 $221.64 6401420400 $221.64 6401420500 $221.64 6401420600 $221.64 6401420700 $221.64 6401420900 $221.64 6401421000 $221.64 6401421100 $221.64 6401421200 $221.64 6401421300 $221.64 6401421400 $221.64 6401421500 $221.64 6401421600 $221.64 6401421700 $221.64 6401421800 $221.64 6401421900 $221.64 6401422000 $221.64 6401422100 $221.64 6401422200 $221.64 6401422300 $221.64 6401422400 $221.64 6401422500 $221.64 6401422600 $221.64 6401422700 $221.64 6401422800 $221.64 6401510100 $221.64 6401510200 $221.64 6401510300 $221.64 6401510400 $221.64 6401510500 $221.64 6401510600 $221.64 6401510700 $221.64 6401510800 $221.64 6401510900 $221.64 6401511000 $221.64 6401511100 $221.64 6401511200 $221.64 6401511300 $221.64 6401511400 $221.64 6401511500 $221.64 6401511600 $221.64 6401511700 $221.64 6401511800 $221.64 6401511900 $221.64 6401512000 $221.64 6401512100 $221.64 6401512200 $221.64 6401512300 $221.64 6401512400 $221.64 6401512500 $221.64 6401512600 $221.64 6401512700 $221.64 6401512800 $221.64 6401512900 $221.64 6401513000 $221.64 6401513100 $221.64 6401513200 $221.64 6401513300 $221.64 6401513400 $221.64 6401513500 $221.64 6401513600 $221.64 6401513700 $221.64 6401513800 $221.64 6401513900 $221.64 6401514000 $221.64 6401514100 $221.64 6401514200 $221.64 6401514300 $221.64 6401514400 $221.64 6401514500 $221.64 6401520100 $221.64 6401520200 $221.64 6401520300 $221.64 6401520400 $221.64 6401520500 $221.64 6401520600 $221.64 6401520700 $221.64 6401520800 $221.64 6401520900 $221.64 6401521000 $221.64 6401521100 $221.64 6401521200 $221.64 6401521300 $221.64 6401521400 $221.64 6401521500 $221.64 6401521600 $221.64 6401521700 $221.64 6401521800 $221.64 6401521900 $221.64 6401522000 $221.64 6401522100 $221.64 6401522200 $221.64 6401522300 $221.64 6401522400 $221.64 6401522500 $221.64 6401522600 $221.64 6401522700 $221.64 6401522800 $221.64 6401522900 $221.64 6401523000 $221.64 6401523100 $221.64 6401523200 $221.64 6401523300 $221.64 Assessment Roll Page 16 of 189 City of Chula Vista Engineer's ReportPage 231 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-11 - OSD 9 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6401523400 $221.64 6401523500 $221.64 6401523600 $221.64 6401523700 $221.64 6401523800 $221.64 6401523900 $221.64 6401524000 $221.64 6401524100 $221.64 6401524200 $221.64 6401524300 $221.64 6401524400 $221.64 6401524500 $221.64 6401524600 $221.64 6401524700 $221.64 6401524800 $221.64 6401524900 $221.64 6401525000 $221.64 6401525100 $221.64 6401525200 $221.64 6401525300 $221.64 6401525400 $221.64 6401525500 $221.64 6401525600 $221.64 6401610100 $221.64 6401610200 $221.64 6401610300 $221.64 6401610400 $221.64 6401610500 $221.64 6401610600 $221.64 6401610700 $221.64 6401610800 $221.64 6401610900 $221.64 6401611000 $221.64 6401611100 $221.64 6401611200 $221.64 6401611300 $221.64 6401611400 $221.64 6401611500 $221.64 6401611600 $221.64 6401611700 $221.64 6401611800 $221.64 6401611900 $221.64 6401612000 $221.64 6401612100 $221.64 6401612200 $221.64 6401612300 $221.64 6401612400 $221.64 6401612500 $221.64 6401612600 $221.64 6401612700 $221.64 6401612800 $221.64 6401612900 $221.64 6401613000 $221.64 6401613100 $221.64 6401613200 $221.64 6401613300 $221.64 6401613400 $221.64 6401613500 $221.64 6401613600 $221.64 6401613700 $221.64 6401613800 $221.64 6401613900 $221.64 6401614000 $221.64 6401614100 $221.64 6401614200 $221.64 6401614300 $221.64 6401614400 $221.64 6401620100 $221.64 6401620200 $221.64 6401620300 $221.64 6401620400 $221.64 6401620500 $221.64 6401620600 $221.64 6401620700 $221.64 6401620800 $221.64 6401620900 $221.64 6401621000 $221.64 6401621100 $221.64 6401621200 $221.64 6401621300 $221.64 6401621400 $221.64 6401621500 $221.64 6401621600 $221.64 6401621700 $221.64 6401621800 $221.64 6401621900 $221.64 6401622000 $221.64 6401622100 $221.64 6401622200 $221.64 6401622300 $221.64 6401622400 $221.64 6401622500 $221.64 6401622600 $221.64 6401622700 $221.64 6401622800 $221.64 6401622900 $221.64 6401623000 $221.64 6401623100 $221.64 6401623200 $221.64 6401623300 $221.64 6401623400 $221.64 6401623500 $221.64 6401623600 $221.64 6401623700 $221.64 6401623800 $221.64 6401623900 $221.64 6401624000 $221.64 6401624100 $221.64 6401624200 $221.64 6401624300 $221.64 6401624400 $221.64 6401624500 $221.64 6401624600 $221.64 6401624700 $221.64 6401624800 $221.64 6401624900 $221.64 6401625000 $221.64 6401625100 $221.64 6401625200 $221.64 6401710100 $221.64 6401710200 $221.64 6401710300 $221.64 6401710400 $221.64 6401710500 $221.64 6401710600 $221.64 6401710700 $221.64 6401710800 $221.64 6401710900 $221.64 6401711000 $221.64 Page 17 of 189 City of Chula Vista Engineer's ReportPage 232 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-11 - OSD 9 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6401711100 $221.64 6401711200 $221.64 6401711300 $221.64 6401711400 $221.64 6401711500 $221.64 6401711600 $221.64 6401711700 $221.64 6401711800 $221.64 6401711900 $221.64 6401712000 $221.64 6401712100 $221.64 6401712200 $221.64 6401712300 $221.64 6401712400 $221.64 6401712500 $221.64 6401712600 $221.64 6401712700 $221.64 6401712800 $221.64 6401712900 $221.64 6401713000 $221.64 6401713100 $221.64 6401713200 $221.64 6401713300 $221.64 6401713400 $221.64 6401713500 $221.64 6401713600 $221.64 6401713700 $221.64 6401713800 $221.64 6401713900 $221.64 6401714000 $221.64 6401714100 $221.64 6401714200 $221.64 6401714300 $221.64 6401714400 $221.64 6401714500 $221.64 6401720100 $221.64 6401720200 $221.64 6401720300 $221.64 6401720400 $221.64 6401720500 $221.64 6401720600 $221.64 6401720700 $221.64 6401720800 $221.64 6401720900 $221.64 6401721000 $221.64 6401721100 $221.64 6401721200 $221.64 6401721300 $221.64 6401721400 $221.64 6401721500 $221.64 6401721600 $221.64 6401721700 $221.64 6401721800 $221.64 6401721900 $221.64 6401722000 $221.64 6401722100 $221.64 6401722200 $221.64 6401722300 $221.64 6401722400 $221.64 6401722500 $221.64 6401722600 $221.64 6401722700 $221.64 6401722800 $221.64 6401722900 $221.64 6401723000 $221.64 6401723100 $221.64 6401723200 $221.64 6401723300 $221.64 6401723400 $221.64 6401723500 $221.64 6401723600 $221.64 6401723700 $221.64 6401723800 $221.64 6401723900 $221.64 6401724000 $221.64 6401724100 $221.64 6401724200 $221.64 6401724300 $221.64 6401724400 $221.64 6401724500 $221.64 6401724600 $221.64 6401724700 $221.64 6401724800 $221.64 6401800100 $221.64 6401800200 $221.64 6401800300 $221.64 6401800400 $221.64 6401800500 $221.64 6401800600 $221.64 6401800700 $443.30 6401800800 $221.64 6401800900 $221.64 6401801000 $221.64 6401801100 $221.64 6401801200 $221.64 6401801300 $221.64 6401801400 $221.64 6401801500 $221.64 6401801600 $221.64 6401801700 $221.64 6401801800 $221.64 6401801900 $221.64 6401802000 $221.64 6401802100 $221.64 6401802200 $221.64 6401802300 $221.64 6401802400 $221.64 6401802500 $221.64 6401802600 $221.64 6401802700 $221.64 6401802800 $221.64 6401802900 $221.64 6401803000 $221.64 6401803100 $221.64 6401803200 $221.64 6401803300 $221.64 6401803400 $221.64 6401803500 $221.64 6401803600 $221.64 6401803700 $221.64 6401803800 $221.64 6401803900 $221.64 6401804000 $221.64 6401804100 $221.64 6401804200 $221.64 6401804300 $221.64 Totals Parcels 384 Levy $85,331.42 Page 18 of 189 City of Chula Vista Engineer's ReportPage 233 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-12 - OSD 10 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6400501900 $711.96 6400804700 $149.56 6401910100 $149.56 6401910200 $149.56 6401910300 $149.56 6401910400 $149.56 6401910500 $149.56 6401910600 $149.56 6401910700 $149.56 6401910800 $149.56 6401910900 $149.56 6401911000 $149.56 6401911100 $149.56 6401911200 $149.56 6401911300 $149.56 6401911400 $149.56 6401911500 $149.56 6401911600 $149.56 6401911700 $149.56 6401911800 $149.56 6401911900 $149.56 6401912000 $149.56 6401920100 $149.56 6401920200 $149.56 6401920300 $149.56 6401920400 $149.56 6401920500 $149.56 6401920600 $149.56 6401920700 $149.56 6401920800 $149.56 6401920900 $149.56 6401921000 $149.56 6401921100 $149.56 6401921200 $149.56 6401921300 $149.56 6401921400 $149.56 6401921500 $149.56 6401921600 $149.56 6401921700 $149.56 6401921800 $149.56 6401921900 $149.56 6401922000 $149.56 6401922100 $149.56 6401922200 $149.56 6401922300 $149.56 6401922400 $149.56 6401922500 $149.56 6401922600 $149.56 6401922700 $149.56 6401922800 $149.56 6401922900 $149.56 6401923000 $149.56 6401923100 $149.56 6401923200 $149.56 6401923300 $149.56 6401923400 $149.56 6401930100 $149.56 6401930200 $149.56 6401930300 $149.56 6401930400 $149.56 6401930500 $149.56 6401930600 $149.56 6401930700 $149.56 6401930800 $149.56 6401930900 $149.56 6401931000 $149.56 6401931100 $149.56 6401931200 $149.56 6401931300 $149.56 6401931400 $149.56 6401931500 $149.56 6401931600 $149.56 6401931700 $149.56 6401931800 $149.56 6401931900 $149.56 6401932000 $149.56 6401932100 $149.56 6401932200 $149.56 6401932300 $149.56 6401932400 $149.56 6401932500 $149.56 6401932600 $149.56 6401932700 $149.56 6401932800 $149.56 6401932900 $149.56 6401933000 $149.56 6401933100 $149.56 6401933200 $149.56 6401933300 $149.56 6401933800 $149.56 6401940100 $149.56 6401940200 $149.56 6401940300 $149.56 6401940400 $149.56 6401940500 $149.56 6401940600 $149.56 6401940700 $149.56 6401940800 $149.56 6401940900 $149.56 6401941000 $149.56 6401941100 $149.56 6401941200 $149.56 6401941300 $149.56 6401941400 $149.56 6401941500 $149.56 6401941600 $149.56 6401941700 $149.56 6401941800 $149.56 6401941900 $149.56 6401942000 $149.56 6401942100 $149.56 6401942200 $149.56 6401942300 $149.56 6401942400 $149.56 6401942500 $149.56 6401942600 $149.56 6401942700 $149.56 6401942800 $149.56 6401942900 $149.56 6401943000 $149.56 6401950100 $149.56 6401950200 $149.56 6401950300 $149.56 6401950400 $149.56 6401950500 $149.56 6401950600 $149.56 6401950700 $149.56 6401950800 $149.56 6401950900 $149.56 6401951000 $149.56 6401951100 $149.56 6401951200 $149.56 6401951300 $149.56 6401951400 $149.56 6401951500 $149.56 6401951600 $149.56 6401951700 $149.56 6401951800 $149.56 6401951900 $149.56 6401960100 $149.56 6401960200 $149.56 Assessment Roll Page 19 of 189 City of Chula Vista Engineer's ReportPage 234 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-12 - OSD 10 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6401960300 $149.56 6401960400 $149.56 6401960500 $149.56 6401960600 $149.56 6401960700 $149.56 6401960800 $149.56 6401960900 $149.56 6401961000 $149.56 6401961100 $149.56 6401961200 $149.56 6401961300 $149.56 6401961400 $149.56 6401961500 $149.56 6401961600 $149.56 6401961700 $149.56 6401961800 $149.56 6401961900 $149.56 6401962000 $149.56 6401962100 $149.56 6401962200 $149.56 6401962300 $149.56 6401970100 $149.56 6401970200 $149.56 6401970300 $149.56 6401970400 $149.56 6401970500 $149.56 6401970600 $149.56 6401970700 $149.56 6401970800 $149.56 6401970900 $149.56 6401971000 $149.56 6401971100 $149.56 6401971200 $149.56 6401971300 $149.56 6401971400 $149.56 6401971500 $149.56 6401971600 $149.56 6401971700 $149.56 6401971800 $149.56 6401971900 $149.56 6401972000 $149.56 6401972100 $149.56 6401972200 $149.56 6401972300 $149.56 6401972400 $149.56 6401972500 $149.56 6401972600 $149.56 6401972700 $149.56 6401972800 $149.56 6401972900 $149.56 6401973000 $149.56 6401973100 $149.56 6401973200 $149.56 6401973300 $149.56 6401973400 $149.56 6401980100 $149.56 6401980200 $149.56 6401980300 $149.56 6401980400 $149.56 6401980500 $149.56 6401980600 $149.56 6401980700 $149.56 6401980800 $149.56 6401980900 $149.56 6401981000 $149.56 6401981100 $149.56 6401981200 $149.56 6401981300 $149.56 6401981400 $149.56 6401981500 $149.56 6401981600 $149.56 6401981700 $149.56 6401981800 $149.56 6401981900 $149.56 6401982000 $149.56 6401982100 $149.56 6401982200 $149.56 6401982300 $149.56 6401982400 $149.56 6401982500 $149.56 6401982600 $149.56 6402000100 $149.56 6402000200 $149.56 6402000300 $149.56 6402000400 $149.56 6402000500 $149.56 6402000600 $149.56 6402000700 $149.56 6402000800 $149.56 6402000900 $149.56 6402001000 $149.56 6402001100 $149.56 6402001200 $149.56 6402001300 $149.56 6402001400 $149.56 6402001500 $149.56 6402001600 $149.56 6402001700 $149.56 6402001800 $149.56 6402001900 $149.56 6402002000 $149.56 6402002100 $149.56 6402002200 $149.56 6402002300 $149.56 6402002400 $149.56 6402002500 $149.56 6402002600 $149.56 6402002700 $149.56 6402002800 $149.56 6402002900 $149.56 6402003000 $149.56 6402003100 $149.56 6402003200 $149.56 6402003300 $149.56 6402003400 $149.56 6402003500 $149.56 6402003600 $149.56 6402003700 $149.56 6402003800 $149.56 6402003900 $149.56 6402004000 $149.56 6402004100 $149.56 6402004200 $149.56 6402004300 $149.56 6402004400 $149.56 6402004500 $149.56 6402004600 $149.56 6402004700 $149.56 6402004800 $149.56 6402004900 $149.56 6402005000 $149.56 6402005100 $149.56 6402005200 $149.56 6402005300 $149.56 6402005400 $149.56 6402005500 $149.56 6402005600 $149.56 6402005700 $149.56 6402005800 $149.56 6402005900 $149.56 6402006000 $149.56 Page 20 of 189 City of Chula Vista Engineer's ReportPage 235 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-12 - OSD 10 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402006100 $149.56 6402006200 $149.56 6402006300 $149.56 6402006400 $149.56 6402006500 $149.56 6402006600 $149.56 6402006700 $149.56 6402006800 $149.56 6402006900 $149.56 6402007000 $149.56 6402007100 $149.56 6402007200 $149.56 6402007300 $149.56 6402007400 $149.56 6402007500 $149.56 6402007600 $149.56 6402110300 $149.56 6402110400 $149.56 6402110500 $149.56 6402110600 $149.56 6402110700 $149.56 6402110800 $149.56 6402110900 $149.56 6402111000 $149.56 6402111100 $149.56 6402111200 $149.56 6402111300 $149.56 6402112500 $149.56 6402112600 $149.56 6402120100 $149.56 6402120200 $149.56 6402120300 $149.56 6402120400 $149.56 6402120500 $149.56 6402120600 $149.56 6402120700 $149.56 6402120800 $149.56 6402120900 $149.56 6402121000 $149.56 6402121100 $149.56 6402121200 $149.56 6402121300 $149.56 6402121400 $149.56 6402130100 $149.56 6402130200 $149.56 6402130300 $149.56 6402130400 $149.56 6402130500 $149.56 6402130600 $149.56 6402130700 $149.56 6402130800 $149.56 6402130900 $149.56 6402131000 $149.56 6402131100 $149.56 6402131200 $149.56 6402131300 $149.56 6402131400 $149.56 6402131500 $149.56 6402131600 $149.56 6402131700 $149.56 6402131800 $149.56 6402131900 $149.56 6402132000 $149.56 6402132100 $149.56 6402210100 $149.56 6402210200 $149.56 6402210300 $149.56 6402210400 $149.56 6402210500 $149.56 6402210600 $149.56 6402210700 $149.56 6402210800 $149.56 6402210900 $149.56 6402211000 $149.56 6402211100 $149.56 6402211200 $149.56 6402211300 $149.56 6402211400 $149.56 6402211500 $149.56 6402211600 $149.56 6402211700 $149.56 6402211800 $149.56 6402211900 $149.56 6402212000 $149.56 6402212100 $149.56 6402212200 $149.56 6402212300 $149.56 6402212400 $149.56 6402212500 $149.56 6402220100 $149.56 6402220200 $149.56 6402220300 $149.56 6402220400 $149.56 6402220500 $149.56 6402220600 $149.56 6402220700 $149.56 6402220800 $149.56 6402220900 $149.56 6402221000 $149.56 6402221100 $149.56 6402221200 $149.56 6402221300 $149.56 6402221400 $149.56 6402221500 $149.56 6402221600 $149.56 6402221700 $149.56 6402221800 $149.56 6402221900 $149.56 6402222000 $149.56 6402222100 $149.56 6402222200 $149.56 6402222300 $149.56 6402222400 $149.56 6402222500 $149.56 6402222600 $149.56 6402222700 $149.56 6402222800 $149.56 6402222900 $149.56 6402223000 $149.56 6402223100 $149.56 6402223200 $149.56 6402223300 $149.56 6402223400 $149.56 6402223500 $149.56 6402310100 $149.56 6402310200 $149.56 6402310300 $149.56 6402310400 $149.56 6402310500 $149.56 6402310600 $149.56 6402310700 $149.56 6402310800 $149.56 6402310900 $149.56 6402311000 $149.56 6402311100 $149.56 6402311200 $149.56 6402311300 $149.56 6402311400 $149.56 6402311500 $149.56 6402311600 $149.56 6402311700 $149.56 Page 21 of 189 City of Chula Vista Engineer's ReportPage 236 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-12 - OSD 10 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402311800 $149.56 6402311900 $149.56 6402312000 $149.56 6402312100 $149.56 6402312200 $149.56 6402312300 $149.56 6402312400 $149.56 6402312500 $149.56 6402312600 $149.56 6402312700 $149.56 6402312800 $149.56 6402312900 $149.56 6402313000 $149.56 6402313100 $149.56 6402313200 $149.56 6402313300 $149.56 6402313400 $149.56 6402313500 $149.56 6402313600 $149.56 6402313700 $149.56 6402313800 $149.56 6402313900 $149.56 6402314000 $149.56 6402314100 $149.56 6402314200 $149.56 6402314300 $149.56 6402314400 $149.56 6402314500 $149.56 6402314600 $149.56 6402314700 $149.56 6402314800 $149.56 6402314900 $149.56 6402315000 $149.56 6402315100 $149.56 6402315200 $149.56 6402315300 $149.56 6402315400 $149.56 6402315500 $149.56 6402315600 $149.56 6402315700 $149.56 6402315800 $149.56 6402315900 $149.56 6402316000 $149.56 6402316100 $149.56 6402316200 $149.56 6402316300 $149.56 6402316400 $149.56 6402316500 $149.56 6402316600 $149.56 6402316700 $149.56 6402320100 $149.56 6402320200 $149.56 6402320300 $149.56 6402320400 $149.56 6402320500 $149.56 6402320600 $149.56 6402321000 $149.56 6402321100 $149.56 6402321200 $149.56 6402321300 $149.56 6402321400 $149.56 6402321500 $149.56 6402321600 $149.56 6402321700 $149.56 6402321800 $149.56 6402321900 $149.56 6402322000 $149.56 6402322100 $149.56 6402322200 $149.56 6402322300 $149.56 6402322400 $149.56 6402322500 $149.56 6402322600 $149.56 6402322700 $149.56 6402322800 $149.56 6402323100 $149.56 6402323200 $149.56 6402323300 $149.56 6402323400 $149.56 6402323500 $149.56 6402323600 $149.56 6402323700 $149.56 6402323800 $149.56 6402323900 $149.56 6402324000 $149.56 6402324100 $149.56 6402324200 $149.56 6402324300 $149.56 6402324400 $149.56 6402324500 $149.56 6402324600 $149.56 6402324700 $149.56 6402324800 $149.56 6402324900 $149.56 6402325000 $149.56 6402325300 $149.56 6402325600 $149.56 6402325700 $149.56 6402330100 $149.56 6402330200 $149.56 6402330300 $149.56 6402330400 $149.56 6402330500 $149.56 6402330600 $149.56 6402330700 $149.56 6402330800 $149.56 6402330900 $149.56 6402331000 $149.56 6402331100 $149.56 6402331200 $149.56 6402331300 $149.56 6402331400 $149.56 6402331500 $149.56 6402331600 $149.56 6402331700 $149.56 6402331800 $149.56 6402331900 $149.56 6402332000 $149.56 6402332100 $149.56 6402332200 $149.56 6402332300 $149.56 6402332400 $149.56 6402332500 $149.56 6402332600 $149.56 6402332700 $149.56 6402332800 $149.56 6402332900 $149.56 6402333000 $149.56 6402333100 $149.56 6402333200 $149.56 6402333300 $149.56 6402333400 $149.56 6402333500 $149.56 6402333600 $149.56 6402333700 $149.56 6402333800 $149.56 6402333900 $149.56 6402334000 $149.56 6402334100 $149.56 6402334200 $149.56 6402334300 $149.56 Page 22 of 189 City of Chula Vista Engineer's ReportPage 237 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-12 - OSD 10 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402334400 $149.56 6402334500 $149.56 6402334600 $149.56 6402340100 $149.56 6402340200 $149.56 6402340300 $149.56 6402340400 $149.56 6402340500 $149.56 6402340600 $149.56 6402340700 $149.56 6402340800 $149.56 6402340900 $149.56 6402341000 $149.56 6402341100 $149.56 6402341200 $149.56 6402341300 $149.56 6402341400 $149.56 6402341500 $149.56 6402341600 $149.56 6402341700 $149.56 6402341800 $149.56 6402341900 $149.56 6402342000 $149.56 6402342100 $149.56 6402342200 $149.56 6402342300 $149.56 6402342400 $149.56 6402342500 $149.56 6402342600 $149.56 6402342700 $149.56 6402342800 $149.56 6402342900 $149.56 6402343000 $149.56 6402343100 $149.56 6402343200 $149.56 6402343300 $149.56 6402343400 $149.56 6402343500 $149.56 6402343600 $149.56 6402343700 $149.56 6402343800 $149.56 6402343900 $149.56 6402344000 $149.56 6402344100 $149.56 6402344200 $149.56 6402344300 $149.56 6402344400 $149.56 6402344500 $149.56 6402344600 $149.56 6402344800 $149.56 6402345200 $149.56 6402345300 $149.56 6402345400 $149.56 6402345500 $149.56 6402345600 $149.56 6402345700 $149.56 6402345800 $149.56 6402345900 $149.56 6402346000 $149.56 6402346100 $149.56 6403000100 $149.56 6403000200 $149.56 6403000300 $149.56 6403000400 $149.56 6403000500 $149.56 6403000600 $149.56 6403000700 $149.56 6403000800 $149.56 6403000900 $149.56 6403001000 $149.56 6403001100 $149.56 6403001200 $149.56 6403001300 $149.56 6403001400 $149.56 6403001500 $149.56 6403001600 $149.56 6403001700 $149.56 6403001800 $149.56 6403001900 $149.56 6403002000 $149.56 6403002100 $149.56 6403002200 $149.56 6403002300 $149.56 6403002400 $149.56 6403002500 $149.56 6403002600 $149.56 6403002700 $149.56 6403002800 $149.56 6403002900 $149.56 Totals Parcels 653 Levy $98,225.08 Page 23 of 189 City of Chula Vista Engineer's ReportPage 238 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5921610100 $151.36 5921610200 $151.36 5921610300 $151.36 5921610400 $151.36 5921610500 $151.36 5921610600 $151.36 5921610700 $151.36 5921610800 $151.36 5921610900 $151.36 5921611000 $151.36 5921611100 $151.36 5921611200 $151.36 5921611300 $151.36 5921611400 $151.36 5921611500 $151.36 5921611600 $151.36 5921611700 $151.36 5921611800 $151.36 5921611900 $151.36 5921612000 $151.36 5921612100 $151.36 5921612200 $151.36 5921612300 $151.36 5921612400 $151.36 5921612500 $151.36 5921612600 $151.36 5921612700 $151.36 5921612800 $151.36 5921612900 $151.36 5921613000 $151.36 5921613100 $151.36 5921613200 $151.36 5921613300 $151.36 5921613400 $151.36 5921620100 $151.36 5921620400 $151.36 5921620500 $151.36 5921620600 $151.36 5921620700 $151.36 5921620800 $151.36 5921620900 $151.36 5921621000 $151.36 5921621100 $151.36 5921621200 $151.36 5921621300 $151.36 5921621400 $151.36 5921621500 $151.36 5921621600 $151.36 5921621700 $151.36 5921621800 $151.36 5921621900 $151.36 5921622000 $151.36 5921622100 $151.36 5921622200 $151.36 5921622300 $151.36 5921622400 $151.36 5921622500 $151.36 5921622600 $151.36 5921622800 $151.36 5921622900 $151.36 5921623000 $151.36 5921623100 $151.36 5921623200 $151.36 5921623300 $151.36 5921623400 $151.36 5921623500 $151.36 5921623600 $151.36 5921623700 $151.36 5921623800 $151.36 5921623900 $151.36 5921624000 $151.36 5921624100 $151.36 5921624200 $151.36 5921624400 $151.36 5921624500 $151.36 5921624600 $151.36 5921710100 $151.36 5921710200 $151.36 5921710300 $151.36 5921710400 $151.36 5921710500 $151.36 5921710600 $151.36 5921710700 $151.36 5921710800 $151.36 5921710900 $151.36 5921711000 $151.36 5921711100 $151.36 5921711200 $151.36 5921711300 $151.36 5921711400 $151.36 5921711500 $151.36 5921711600 $151.36 5921711700 $151.36 5921711800 $151.36 5921711900 $151.36 5921712000 $151.36 5921712100 $151.36 5921712200 $151.36 5921712300 $151.36 5921712400 $151.36 5921712500 $151.36 5921712600 $151.36 5921712700 $151.36 5921712800 $151.36 5921712900 $151.36 5921713000 $151.36 5921713100 $151.36 5921713200 $151.36 5921713300 $151.36 5921713400 $151.36 5921713500 $151.36 5921713600 $151.36 5921713700 $151.36 5921713800 $151.36 5921713900 $151.36 5921714000 $151.36 5921714100 $151.36 5921714200 $151.36 5921714300 $151.36 5921714400 $151.36 5921714500 $151.36 5921714600 $151.36 5921714700 $151.36 5921714800 $151.36 5921714900 $151.36 5921715000 $151.36 5921715100 $151.36 5921715200 $151.36 5921715300 $151.36 5921715400 $151.36 5921715500 $151.36 5921715600 $151.36 5921715700 $151.36 5921715800 $151.36 5921715900 $151.36 5921716000 $151.36 5921720100 $151.36 5921720200 $151.36 5921720300 $151.36 5921720400 $151.36 5921720500 $151.36 Assessment Roll Page 24 of 189 City of Chula Vista Engineer's ReportPage 239 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5921720600 $151.36 5921720700 $151.36 5921720800 $151.36 5921720900 $151.36 5921721000 $151.36 5921721100 $151.36 5921721200 $151.36 5921721300 $151.36 5921721400 $151.36 5921721500 $151.36 5921721600 $151.36 5921721700 $151.36 5921721800 $151.36 5921721900 $151.36 5921722000 $151.36 5921722100 $151.36 5921722200 $151.36 5921722300 $151.36 5921722400 $151.36 5921722500 $151.36 5921722600 $151.36 5921722700 $151.36 5921722800 $151.36 5921722900 $151.36 5921723000 $151.36 5921723100 $151.36 5921723200 $151.36 5921723300 $151.36 5921723400 $151.36 5921723500 $151.36 5921723600 $151.36 5921723700 $151.36 5921723800 $151.36 5921723900 $151.36 5921724100 $151.36 5921724200 $151.36 5921724300 $151.36 5921724400 $151.36 5921724500 $151.36 5921724600 $151.36 5921724700 $151.36 5921724800 $151.36 5921724900 $151.36 5921725000 $151.36 5921725100 $151.36 5921725200 $151.36 5921725300 $151.36 5921725400 $151.36 5921725500 $151.36 5921725600 $151.36 5921725700 $151.36 5921725800 $151.36 5921725900 $151.36 5921726000 $151.36 5921726100 $151.36 5921726200 $151.36 5921726500 $151.36 5921726600 $151.36 5921810100 $151.36 5921810200 $151.36 5921810300 $151.36 5921810400 $151.36 5921810500 $151.36 5921810600 $151.36 5921810700 $151.36 5921810800 $151.36 5921810900 $151.36 5921811000 $151.36 5921811100 $151.36 5921811200 $151.36 5921811300 $151.36 5921811400 $151.36 5921811500 $151.36 5921811600 $151.36 5921811700 $151.36 5921811800 $151.36 5921811900 $151.36 5921812000 $151.36 5921812100 $151.36 5921812200 $151.36 5921812300 $151.36 5921812400 $151.36 5921812500 $151.36 5921812600 $151.36 5921812700 $151.36 5921812800 $151.36 5921812900 $151.36 5921813000 $151.36 5921813100 $151.36 5921813200 $151.36 5921813300 $151.36 5921813400 $151.36 5921813500 $151.36 5921813600 $151.36 5921813700 $151.36 5921813800 $151.36 5921820100 $151.36 5921820200 $151.36 5921820300 $151.36 5921820400 $151.36 5921820500 $151.36 5921820600 $151.36 5921820700 $151.36 5921820800 $151.36 5921820900 $151.36 5921821000 $151.36 5921821100 $151.36 5921821200 $151.36 5921821300 $151.36 5921821400 $151.36 5921821500 $151.36 5921821600 $151.36 5921821700 $151.36 5921821800 $151.36 5921821900 $151.36 5921822000 $151.36 5921822100 $151.36 5921822200 $151.36 5921822300 $151.36 5921822400 $151.36 5921822500 $151.36 5921822600 $151.36 5921822700 $151.36 5921822800 $151.36 5921822900 $151.36 5921823000 $151.36 5921823100 $151.36 5921823200 $151.36 5921823300 $151.36 5921823400 $151.36 5921823500 $151.36 5921823600 $151.36 5921823700 $151.36 5921823800 $151.36 5921823900 $151.36 5921824000 $151.36 5921824100 $151.36 5921824200 $151.36 5921824300 $151.36 5921824400 $151.36 5921824500 $151.36 Page 25 of 189 City of Chula Vista Engineer's ReportPage 240 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5921824600 $151.36 5921824700 $151.36 5921830100 $151.36 5921830200 $151.36 5921830300 $151.36 5921830400 $151.36 5921830500 $151.36 5921830600 $151.36 5921830700 $151.36 5921830800 $151.36 5921830900 $151.36 5921831000 $151.36 5921831100 $151.36 5921831200 $151.36 5921831300 $151.36 5921831400 $151.36 5921831500 $151.36 5921831600 $151.36 5921831700 $151.36 5921831800 $151.36 5921831900 $151.36 5921832000 $151.36 5921832100 $151.36 5921832200 $151.36 5921832300 $151.36 5921832400 $151.36 5921832500 $151.36 5921832600 $151.36 5921832700 $151.36 5921832800 $151.36 5921832900 $151.36 5921833000 $151.36 5921833100 $151.36 5921833200 $151.36 5921833300 $151.36 5921833400 $151.36 5921833500 $151.36 5921833600 $151.36 5921912001 $151.36 5921912002 $151.36 5921912003 $151.36 5921912004 $151.36 5921912005 $151.36 5921912006 $151.36 5921912007 $151.36 5921912008 $151.36 5921912009 $151.36 5921912010 $151.36 5921912011 $151.36 5921912012 $151.36 5921912013 $151.36 5921912014 $151.36 5921912015 $151.36 5921912016 $151.36 5921912017 $151.36 5921912018 $151.36 5921912019 $151.36 5921912020 $151.36 5921912021 $151.36 5921912022 $151.36 5921912023 $151.36 5921912024 $151.36 5921912025 $151.36 5921912026 $151.36 5921912027 $151.36 5921912028 $151.36 5921912029 $151.36 5921912030 $151.36 5921912031 $151.36 5921912032 $151.36 5921912033 $151.36 5921912034 $151.36 5921912035 $151.36 5921912036 $151.36 5921912037 $151.36 5921912038 $151.36 5921912039 $151.36 5921912040 $151.36 5921912041 $151.36 5921912042 $151.36 5921912043 $151.36 5921912044 $151.36 5921912045 $151.36 5921912046 $151.36 5921912047 $151.36 5921912048 $151.36 5921912101 $151.36 5921912102 $151.36 5921912103 $151.36 5921912104 $151.36 5921912105 $151.36 5921912106 $151.36 5921912107 $151.36 5921912108 $151.36 5921912109 $151.36 5921912110 $151.36 5921912111 $151.36 5921912112 $151.36 5921912113 $151.36 5921912114 $151.36 5921912115 $151.36 5921912116 $151.36 5921912117 $151.36 5921912118 $151.36 5921912119 $151.36 5921912120 $151.36 5921912121 $151.36 5921912122 $151.36 5921912123 $151.36 5921912124 $151.36 5921912125 $151.36 5921912126 $151.36 5921912127 $151.36 5921912128 $151.36 5921912129 $151.36 5921912130 $151.36 5921912131 $151.36 5921912132 $151.36 5921912133 $151.36 5921912134 $151.36 5921912135 $151.36 5921912136 $151.36 5921912137 $151.36 5921912138 $151.36 5921912139 $151.36 5921912140 $151.36 5921912141 $151.36 5921912142 $151.36 5921912143 $151.36 5921912144 $151.36 5921912145 $151.36 5921912146 $151.36 5921912147 $151.36 5921912148 $151.36 5921912149 $151.36 5921912150 $151.36 5921912151 $151.36 5921912152 $151.36 5921920300 $5,146.72 5921922200 $12,412.72 5921922300 $13,320.96 Page 26 of 189 City of Chula Vista Engineer's ReportPage 241 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5922000100 $10,730.94 5922000200 $3,590.60 5922000300 $3,487.66 5922000400 $1,003.60 5922000500 $4,709.26 5922000600 $399.62 5922000700 $1,029.34 5922000800 $3,204.60 5922001000 $322.42 5922001100 $1,120.16 5922001200 $1,080.80 5922001300 $1,260.94 5922001400 $1,775.62 5922001500 $888.56 5922001600 $1,274.56 5922001700 $1,017.22 5922001800 $1,286.68 5922003300 $1,029.34 5922100200 $151.36 5922100300 $151.36 5922100400 $151.36 5922100500 $151.36 5922100600 $151.36 5922100700 $151.36 5922100800 $151.36 5922100900 $151.36 5922101000 $151.36 5922101100 $151.36 5922101200 $151.36 5922101300 $151.36 5922101400 $151.36 5922101500 $151.36 5922101600 $151.36 5922101700 $151.36 5922101900 $151.36 5922102000 $151.36 5922102100 $151.36 5922102200 $151.36 5922102300 $151.36 5922102400 $151.36 5922102500 $151.36 5922102600 $151.36 5922102700 $151.36 5922102800 $151.36 5922102900 $151.36 5922103000 $151.36 5922103100 $151.36 5922103200 $151.36 5922103300 $151.36 5922103400 $151.36 5922103500 $151.36 5922103600 $151.36 5922103700 $151.36 5922103800 $151.36 5922103900 $151.36 5922104000 $151.36 5922104100 $151.36 5922104200 $151.36 5922104300 $151.36 5922104400 $151.36 5922104500 $151.36 5922104600 $151.36 5922104700 $151.36 5922104800 $151.36 5922104900 $151.36 5922105000 $151.36 5922105100 $151.36 5922105200 $151.36 5922105300 $151.36 5922105400 $151.36 5922105500 $151.36 5922105600 $151.36 5922105700 $151.36 5922105800 $151.36 5922105900 $151.36 5922106000 $151.36 5922106100 $151.36 5922106200 $151.36 5922106300 $151.36 5922106400 $151.36 5922106500 $151.36 5922106600 $151.36 5922106700 $151.36 5922106800 $151.36 5922106900 $151.36 5922107000 $151.36 5922107100 $151.36 5922107200 $151.36 5922107300 $151.36 5922107400 $151.36 5922107500 $151.36 5922107600 $151.36 5922107700 $151.36 5922107800 $151.36 5922107900 $151.36 5922108000 $151.36 5922108100 $151.36 5922108200 $151.36 5922108300 $151.36 5922108400 $151.36 5922108500 $151.36 5922108600 $151.36 5922108700 $151.36 5922108800 $151.36 5922109300 $151.36 5922110200 $151.36 5922110300 $151.36 5922110400 $151.36 5922110500 $151.36 5922110600 $151.36 5922110700 $151.36 5922110800 $151.36 5922110900 $151.36 5922111000 $151.36 5922111100 $151.36 5922111200 $151.36 5922111300 $151.36 5922111400 $151.36 5922111500 $151.36 5922111600 $151.36 5922111700 $151.36 5922111800 $151.36 5922111900 $151.36 5922112000 $151.36 5922112100 $151.36 5922112200 $151.36 5922112300 $151.36 5922112400 $151.36 5922112500 $151.36 5922112600 $151.36 5922112700 $151.36 5922112800 $151.36 5922112900 $151.36 5922113000 $151.36 5922113100 $151.36 5922113200 $151.36 5922113300 $151.36 5922113400 $151.36 5922113500 $151.36 5922113600 $151.36 5922114100 $151.36 Page 27 of 189 City of Chula Vista Engineer's ReportPage 242 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5922200101 $151.36 5922200102 $151.36 5922200103 $151.36 5922200104 $151.36 5922200105 $151.36 5922200106 $151.36 5922200107 $151.36 5922200108 $151.36 5922200109 $151.36 5922200110 $151.36 5922200111 $151.36 5922200112 $151.36 5922200113 $151.36 5922200114 $151.36 5922200301 $151.36 5922200302 $151.36 5922200303 $151.36 5922200304 $151.36 5922200305 $151.36 5922200306 $151.36 5922200307 $151.36 5922200308 $151.36 5922200309 $151.36 5922200310 $151.36 5922200311 $151.36 5922200312 $151.36 5922200313 $151.36 5922200314 $151.36 5922200315 $151.36 5922200316 $151.36 5922200317 $151.36 5922200318 $151.36 5922200319 $151.36 5922200320 $151.36 5922200401 $151.36 5922200402 $151.36 5922200403 $151.36 5922200404 $151.36 5922200405 $151.36 5922200406 $151.36 5922200407 $151.36 5922200408 $151.36 5922200409 $151.36 5922200410 $151.36 5922200411 $151.36 5922200412 $151.36 5922200413 $151.36 5922200414 $151.36 5922201301 $151.36 5922201302 $151.36 5922201303 $151.36 5922201304 $151.36 5922201305 $151.36 5922201306 $151.36 5922201307 $151.36 5922201308 $151.36 5922201309 $151.36 5922201310 $151.36 5922201311 $151.36 5922201312 $151.36 5922201313 $151.36 5922201314 $151.36 5922201401 $151.36 5922201402 $151.36 5922201403 $151.36 5922201404 $151.36 5922201405 $151.36 5922201406 $151.36 5922201407 $151.36 5922201408 $151.36 5922201409 $151.36 5922201410 $151.36 5922201411 $151.36 5922201412 $151.36 5922201413 $151.36 5922201414 $151.36 5922201901 $151.36 5922201902 $151.36 5922201903 $151.36 5922201904 $151.36 5922201905 $151.36 5922201906 $151.36 5922201907 $151.36 5922201908 $151.36 5922201909 $151.36 5922201910 $151.36 5922201911 $151.36 5922201912 $151.36 5922201913 $151.36 5922201914 $151.36 5922201915 $151.36 5922201916 $151.36 5922201917 $151.36 5922201918 $151.36 5922202001 $151.36 5922202002 $151.36 5922202003 $151.36 5922202004 $151.36 5922202005 $151.36 5922202006 $151.36 5922202007 $151.36 5922202008 $151.36 5922202009 $151.36 5922202010 $151.36 5922202011 $151.36 5922202012 $151.36 5922202013 $151.36 5922202014 $151.36 5922202015 $151.36 5922202016 $151.36 5922202017 $151.36 5922202018 $151.36 5922202019 $151.36 5922202020 $151.36 5922202301 $151.36 5922202302 $151.36 5922202303 $151.36 5922202304 $151.36 5922202305 $151.36 5922202306 $151.36 5922202307 $151.36 5922202308 $151.36 5922202309 $151.36 5922202310 $151.36 5922202311 $151.36 5922202312 $151.36 5922202313 $151.36 5922202314 $151.36 5922202315 $151.36 5922202316 $151.36 5922202317 $151.36 5922202318 $151.36 5922202319 $151.36 5922202320 $151.36 5922202321 $151.36 5922202322 $151.36 5922202323 $151.36 5922202324 $151.36 5922202401 $151.36 5922202402 $151.36 5922202403 $151.36 Page 28 of 189 City of Chula Vista Engineer's ReportPage 243 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5922202404 $151.36 5922202405 $151.36 5922202406 $151.36 5922202407 $151.36 5922202408 $151.36 5922202409 $151.36 5922202410 $151.36 5922202411 $151.36 5922202412 $151.36 5922202413 $151.36 5922202414 $151.36 5922202415 $151.36 5922202416 $151.36 5922202417 $151.36 5922202418 $151.36 5922202419 $151.36 5922202420 $151.36 5922202421 $151.36 5922202422 $151.36 5922202423 $151.36 5922202424 $151.36 5922202425 $151.36 5922202426 $151.36 5922210801 $151.36 5922210802 $151.36 5922210803 $151.36 5922210804 $151.36 5922210805 $151.36 5922210806 $151.36 5922210807 $151.36 5922210808 $151.36 5922210809 $151.36 5922210810 $151.36 5922210811 $151.36 5922210812 $151.36 5922210813 $151.36 5922210814 $151.36 5922210901 $151.36 5922210902 $151.36 5922210903 $151.36 5922210904 $151.36 5922210905 $151.36 5922210906 $151.36 5922210907 $151.36 5922210908 $151.36 5922210909 $151.36 5922210910 $151.36 5922210911 $151.36 5922210912 $151.36 5922210913 $151.36 5922210914 $151.36 5922210915 $151.36 5922210916 $151.36 5922210917 $151.36 5922210918 $151.36 5922211001 $151.36 5922211002 $151.36 5922211003 $151.36 5922211004 $151.36 5922211005 $151.36 5922211006 $151.36 5922211007 $151.36 5922211008 $151.36 5922211009 $151.36 5922211010 $151.36 5922211011 $151.36 5922211012 $151.36 5922211101 $151.36 5922211102 $151.36 5922211103 $151.36 5922211104 $151.36 5922211105 $151.36 5922211106 $151.36 5922211107 $151.36 5922211108 $151.36 5922211109 $151.36 5922211110 $151.36 5922211111 $151.36 5922211112 $151.36 5922211113 $151.36 5922211114 $151.36 5922211115 $151.36 5922211116 $151.36 5922211117 $151.36 5922211118 $151.36 5922211119 $151.36 5922211120 $151.36 5922211121 $151.36 5922211122 $151.36 5922300100 $151.36 5922300200 $151.36 5922300300 $151.36 5922300400 $151.36 5922300500 $151.36 5922300600 $151.36 5922300700 $151.36 5922300800 $151.36 5922300900 $151.36 5922301000 $151.36 5922301100 $151.36 5922301200 $151.36 5922301300 $151.36 5922301400 $151.36 5922301500 $151.36 5922301600 $151.36 5922301700 $151.36 5922301800 $151.36 5922301900 $151.36 5922302000 $151.36 5922302100 $151.36 5922302200 $151.36 5922302300 $151.36 5922302400 $151.36 5922302500 $151.36 5922302600 $151.36 5922302700 $151.36 5922302800 $151.36 5922302900 $151.36 5922303000 $151.36 5922303100 $151.36 5922303200 $151.36 5922303300 $151.36 5922303400 $151.36 5922303500 $151.36 5922303600 $151.36 5922303700 $151.36 5922303800 $151.36 5922303900 $151.36 5922304000 $151.36 5922304100 $151.36 5922304200 $151.36 5922304300 $151.36 5922304400 $151.36 5922304500 $151.36 5922310100 $151.36 5922310200 $151.36 5922310300 $151.36 5922310400 $151.36 5922310500 $151.36 5922310600 $151.36 5922311100 $151.36 Page 29 of 189 City of Chula Vista Engineer's ReportPage 244 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-14 - OSD 11 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5922311200 $151.36 5922311300 $151.36 5922311400 $151.36 5922311500 $151.36 5922311600 $151.36 5922311700 $151.36 5922311800 $151.36 5922311900 $151.36 5922312000 $151.36 5922312300 $151.36 5922312400 $151.36 5922312500 $151.36 5922312600 $151.36 5922312700 $151.36 5922312800 $151.36 5922312900 $151.36 5922313000 $151.36 5922313100 $151.36 5922313200 $151.36 5922313300 $151.36 5922313400 $151.36 5922313500 $151.36 5922313600 $151.36 5922313700 $151.36 5922313800 $151.36 5922313900 $151.36 5922314000 $151.36 5922314400 $151.36 5922314500 $151.36 5922314600 $151.36 5922314700 $151.36 5922314800 $151.36 5922314900 $151.36 Totals Parcels 879 Levy $199,959.20 Page 30 of 189 City of Chula Vista Engineer's ReportPage 245 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5940700400 $486.58 5940700500 $486.58 5940700600 $486.58 5940700700 $486.58 5940700800 $486.58 5940700900 $486.58 5940701000 $486.58 5940701100 $486.58 5940701200 $486.58 5940701300 $486.58 5940701400 $486.58 5940701500 $486.58 5940701600 $486.58 5940701700 $486.58 5940701800 $486.58 5940701900 $486.58 5940702000 $486.58 5940702100 $486.58 5940702200 $486.58 5940702300 $486.58 5940702400 $486.58 5940702500 $486.58 5940702600 $486.58 5940702700 $486.58 5940702800 $486.58 5940702900 $486.58 5940703000 $486.58 5940703100 $486.58 5940703200 $486.58 5940703300 $486.58 5940703400 $486.58 5940703500 $486.58 5940703600 $486.58 5940703700 $486.58 5940703800 $486.58 5940703900 $486.58 5940704000 $486.58 5940704100 $486.58 5940704200 $486.58 5940704300 $486.58 5940704400 $486.58 5940704500 $486.58 5940704600 $486.58 5940704700 $486.58 5940704800 $486.58 5940704900 $486.58 5940705000 $486.58 5940705100 $486.58 5940705200 $486.58 5940705300 $486.58 5940705400 $486.58 5940705500 $486.58 5940705600 $486.58 5940705700 $486.58 5940705800 $486.58 5940705900 $486.58 5940710100 $486.58 5940710200 $486.58 5940710300 $486.58 5940710400 $486.58 5940710500 $486.58 5940710600 $486.58 5940710700 $486.58 5940710800 $486.58 5940710900 $486.58 5940711000 $486.58 5940711100 $486.58 5940711200 $486.58 5940711300 $486.58 5940711400 $486.58 5940711500 $486.58 5940711600 $486.58 5940711700 $486.58 5940711800 $486.58 5940711900 $486.58 5940712000 $486.58 5940712100 $486.58 5940712200 $486.58 5940712300 $486.58 5940712400 $486.58 5940712500 $486.58 5940712600 $486.58 5940712700 $486.58 5940712800 $486.58 5940712900 $486.58 5940713000 $486.58 5940713100 $486.58 5940713200 $486.58 5940713300 $486.58 5940713400 $486.58 5940713500 $486.58 5940713600 $486.58 5940713700 $486.58 5940713800 $486.58 5940713900 $486.58 5940714000 $486.58 5940714100 $486.58 5940714200 $486.58 5940714300 $486.58 5940714400 $486.58 5940714500 $486.58 5940714600 $486.58 5940714700 $486.58 5940714800 $486.58 5940714900 $486.58 5940715000 $486.58 5940715100 $486.58 5940715200 $486.58 5940715300 $486.58 5940715400 $486.58 5940715500 $486.58 5940715600 $486.58 5940715700 $486.58 5940715800 $486.58 5940715900 $486.58 5940716000 $486.58 5940716100 $486.58 5940716200 $486.58 5940716300 $486.58 5940716400 $486.58 5940716700 $486.58 5941100900 $486.58 5943210100 $486.58 5943210200 $486.58 5943210300 $486.58 5943210400 $486.58 5943210500 $486.58 5943210600 $486.58 5943210700 $486.58 5943210800 $486.58 5943210900 $486.58 5943211000 $486.58 5943211100 $486.58 5943211200 $486.58 5943211300 $486.58 5943211400 $486.58 5943211500 $486.58 5943211600 $486.58 5943211700 $486.58 5943211800 $486.58 5943211900 $486.58 Assessment Roll Page 31 of 189 City of Chula Vista Engineer's ReportPage 246 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5943212000 $486.58 5943212100 $486.58 5943212200 $486.58 5943212300 $486.58 5943212400 $486.58 5943212500 $486.58 5943212600 $486.58 5943212700 $486.58 5943212800 $486.58 5943212900 $486.58 5943213000 $486.58 5943213100 $486.58 5943213200 $486.58 5943213300 $486.58 5943213400 $486.58 5943213500 $486.58 5943213600 $486.58 5943213700 $486.58 5943213800 $486.58 5943213900 $486.58 5943214000 $486.58 5943214100 $486.58 5943214200 $486.58 5943214300 $486.58 5943214400 $486.58 5943214500 $486.58 5943214600 $486.58 5943214700 $486.58 5943214800 $486.58 5943214900 $486.58 5943215000 $486.58 5943215100 $486.58 5943215200 $486.58 5943215300 $486.58 5943215400 $486.58 5943215500 $486.58 5943215600 $486.58 5943215700 $486.58 5943215800 $486.58 5943215900 $486.58 5943216000 $486.58 5943216100 $486.58 5943216200 $486.58 5943216300 $486.58 5943220100 $486.58 5943220200 $486.58 5943220300 $486.58 5943220400 $486.58 5943220500 $486.58 5943220600 $486.58 5943220700 $486.58 5943220800 $486.58 5943220900 $486.58 5943221000 $486.58 5943221100 $486.58 5943221200 $486.58 5943221300 $486.58 5943221400 $486.58 5943221500 $486.58 5943221600 $486.58 5943221700 $486.58 5943221800 $486.58 5943221900 $486.58 5943222000 $486.58 5943222100 $486.58 5943222200 $486.58 5943222300 $486.58 5943222400 $486.58 5943222500 $486.58 5943222600 $486.58 5943222700 $486.58 5943222800 $486.58 5943222900 $486.58 5943223000 $486.58 5943223100 $486.58 5943223200 $486.58 5943223300 $486.58 5943223400 $486.58 5943223500 $486.58 5943223600 $486.58 5943223700 $486.58 5943223800 $486.58 5943223900 $486.58 5943224000 $486.58 5943224100 $486.58 5943224200 $486.58 5943224300 $486.58 5943224400 $486.58 5943224500 $486.58 5943224600 $486.58 5943224700 $486.58 5943224800 $486.58 5943224900 $486.58 5943225000 $486.58 5943225100 $486.58 5943225200 $486.58 5943225300 $486.58 5943225400 $486.58 5943225500 $486.58 5943225600 $486.58 5943225700 $486.58 5943225800 $486.58 5943225900 $486.58 5943226000 $486.58 5943226100 $486.58 5943226200 $486.58 5943226300 $486.58 5943226400 $486.58 5943226500 $486.58 5943226600 $486.58 5943226700 $486.58 5943226800 $486.58 5943226900 $486.58 5943227000 $486.58 5943230100 $486.58 5943230200 $486.58 5943230300 $486.58 5943230400 $486.58 5943230500 $486.58 5943230600 $486.58 5943230700 $486.58 5943230800 $486.58 5943230900 $486.58 5943231000 $486.58 5943231100 $486.58 5943231200 $486.58 5943231300 $486.58 5943231400 $486.58 5943231500 $486.58 5943231600 $486.58 5943231700 $486.58 5943231800 $486.58 5943231900 $486.58 5943232000 $486.58 5943232100 $486.58 5943232200 $486.58 5943232300 $486.58 5943232400 $486.58 5943232500 $486.58 5943232600 $486.58 5943232700 $486.58 Page 32 of 189 City of Chula Vista Engineer's ReportPage 247 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5943232800 $486.58 5943232900 $486.58 5943233000 $486.58 5943233100 $486.58 5943233200 $486.58 5943233300 $486.58 5943233400 $486.58 5943233500 $486.58 5943233600 $486.58 5943233700 $486.58 5943233800 $486.58 5943233900 $486.58 5943234000 $486.58 5943234100 $486.58 5943234200 $486.58 5943234300 $486.58 5943234400 $486.58 5943234500 $486.58 5943234600 $486.58 5943234700 $486.58 5943234800 $486.58 5943234900 $486.58 5943235000 $486.58 5943235100 $486.58 5943235200 $486.58 5943235300 $486.58 5943235400 $486.58 5943235500 $486.58 5943235600 $486.58 5943235700 $486.58 5943235800 $486.58 5943235900 $486.58 5943236000 $486.58 5943236100 $486.58 5943236200 $486.58 5943236300 $486.58 5943236400 $486.58 5943236500 $486.58 5943236600 $486.58 5943410100 $486.58 5943410200 $486.58 5943410300 $486.58 5943410400 $486.58 5943410500 $486.58 5943410600 $486.58 5943410700 $486.58 5943410800 $486.58 5943410900 $486.58 5943411000 $486.58 5943411100 $486.58 5943411200 $486.58 5943411300 $486.58 5943411400 $486.58 5943411500 $486.58 5943411600 $486.58 5943411700 $486.58 5943411800 $486.58 5943411900 $486.58 5943412000 $486.58 5943412100 $486.58 5943412200 $486.58 5943412300 $486.58 5943412400 $486.58 5943412500 $486.58 5943412600 $486.58 5943412700 $486.58 5943412800 $486.58 5943412900 $486.58 5943413000 $486.58 5943413100 $486.58 5943413200 $486.58 5943413300 $486.58 5943413400 $486.58 5943413500 $486.58 5943413600 $486.58 5943413700 $486.58 5943413800 $486.58 5943413900 $486.58 5943414000 $486.58 5943414100 $486.58 5943414200 $486.58 5943414300 $486.58 5943414400 $486.58 5943414500 $486.58 5943414600 $486.58 5943414700 $486.58 5943414800 $486.58 5943414900 $486.58 5943415000 $486.58 5943415100 $486.58 5943415200 $486.58 5943415300 $486.58 5943415400 $486.58 5943415500 $486.58 5943420100 $486.58 5943420200 $486.58 5943420300 $486.58 5943420400 $486.58 5943420500 $486.58 5943420600 $486.58 5943420700 $486.58 5943420800 $486.58 5943420900 $486.58 5943421000 $486.58 5943421100 $486.58 5943421200 $486.58 5943421300 $486.58 5943421400 $486.58 5943421500 $486.58 5943421600 $486.58 5943421700 $486.58 5943421800 $486.58 5943421900 $486.58 5943422000 $486.58 5943422100 $486.58 5943422200 $486.58 5943422300 $486.58 5943422400 $486.58 5943422500 $486.58 5943422600 $486.58 5943422700 $486.58 5943422800 $486.58 5943422900 $486.58 5943423000 $486.58 5943423100 $486.58 5943423200 $486.58 5943423300 $486.58 5943423400 $486.58 5943423500 $486.58 5943423600 $486.58 5943423700 $486.58 5943423800 $486.58 5943423900 $486.58 5943424000 $486.58 5943424100 $486.58 5943424200 $486.58 5943424300 $486.58 5943424400 $486.58 5943424500 $486.58 5943424600 $486.58 5943424700 $486.58 Page 33 of 189 City of Chula Vista Engineer's ReportPage 248 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5943424800 $486.58 5943424900 $486.58 5943425000 $486.58 5943430100 $486.58 5943430200 $486.58 5943430300 $486.58 5943430400 $486.58 5943430500 $486.58 5943430600 $486.58 5943430700 $486.58 5943430800 $486.58 5943430900 $486.58 5943431000 $486.58 5943431100 $486.58 5943431200 $486.58 5943431300 $486.58 5943431400 $486.58 5943431500 $486.58 5943431600 $486.58 5943431700 $486.58 5943431800 $486.58 5943431900 $486.58 5943432000 $486.58 5943432100 $486.58 5943432200 $486.58 5943432300 $486.58 5943432400 $486.58 5943432500 $486.58 5943510100 $486.58 5943510200 $486.58 5943510300 $486.58 5943510400 $486.58 5943510500 $486.58 5943510600 $486.58 5943510700 $486.58 5943510800 $486.58 5943510900 $486.58 5943511000 $486.58 5943511200 $486.58 5943511300 $486.58 5943511400 $486.58 5943511500 $486.58 5943511600 $486.58 5943511800 $486.58 5943512200 $486.58 5943512300 $486.58 5943520100 $486.58 5943520200 $486.58 5943520300 $486.58 5943520400 $486.58 5943520500 $486.58 5943520600 $486.58 5943520700 $486.58 5943520800 $486.58 5943520900 $486.58 5943521000 $486.58 5943521100 $486.58 5943521200 $486.58 5943521300 $486.58 5943521400 $486.58 5943521500 $486.58 5943521600 $486.58 5943521700 $486.58 5943521800 $486.58 5943521900 $486.58 5943610100 $486.58 5943610200 $486.58 5943610300 $486.58 5943610400 $486.58 5943610500 $486.58 5943610600 $486.58 5943610700 $486.58 5943610800 $486.58 5943610900 $486.58 5943611000 $486.58 5943611300 $486.58 5943611400 $486.58 5943611500 $486.58 5943611600 $486.58 5943611700 $486.58 5943611800 $486.58 5943611900 $486.58 5943612000 $486.58 5943612200 $486.58 5943612300 $486.58 5943612400 $486.58 5943612500 $486.58 5943612600 $486.58 5943612700 $486.58 5943612800 $486.58 5943612900 $486.58 5943613000 $486.58 5943613200 $486.58 5943614100 $486.58 5943614400 $486.58 5943620100 $486.58 5943620200 $486.58 5943620300 $486.58 5943620400 $486.58 5943620500 $486.58 5943620600 $486.58 5943620700 $486.58 5943620800 $486.58 5943620900 $486.58 5943621000 $486.58 5943621100 $486.58 5943621200 $486.58 5943621300 $486.58 5943621400 $486.58 5943621500 $486.58 5943621600 $486.58 5943621700 $486.58 5943621800 $486.58 5943621900 $486.58 5943622000 $486.58 5943622100 $486.58 5943622200 $486.58 5943622300 $486.58 5943622400 $486.58 5943622500 $486.58 5943622600 $486.58 5943622700 $486.58 5943622800 $486.58 5943622900 $486.58 5943623000 $486.58 5943623100 $486.58 5943623200 $486.58 5943623300 $486.58 5943623400 $486.58 5943623500 $486.58 5943623600 $486.58 5943623700 $486.58 5943623800 $486.58 5943623900 $486.58 5943624000 $486.58 5943624100 $486.58 5943624200 $486.58 5943710100 $486.58 5943710200 $486.58 5943710300 $486.58 5943710400 $486.58 Page 34 of 189 City of Chula Vista Engineer's ReportPage 249 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5943710500 $486.58 5943710600 $486.58 5943710700 $486.58 5943710800 $486.58 5943710900 $486.58 5943711000 $486.58 5943711100 $486.58 5943711200 $486.58 5943711300 $486.58 5943711400 $486.58 5943711500 $486.58 5943711600 $486.58 5943711700 $486.58 5943711800 $486.58 5943711900 $486.58 5943712000 $486.58 5943712100 $486.58 5943712200 $486.58 5943712300 $486.58 5943712400 $486.58 5943712500 $486.58 5943712600 $486.58 5943712700 $486.58 5943720100 $486.58 5943720200 $486.58 5943720300 $486.58 5943720400 $486.58 5943720500 $486.58 5943720600 $486.58 5943720700 $486.58 5943720800 $486.58 5943720900 $486.58 5943721000 $486.58 5943721100 $486.58 5943721200 $486.58 5943721300 $486.58 5943721400 $486.58 5943721500 $486.58 5943721600 $486.58 5943721700 $486.58 5943721800 $486.58 5943721900 $486.58 5943722000 $486.58 5943722100 $486.58 5943722200 $486.58 5943722300 $486.58 5943722400 $486.58 5943722500 $486.58 5943722600 $486.58 5943722700 $486.58 5943722800 $486.58 5943722900 $486.58 5943723000 $486.58 5943723100 $486.58 5943723200 $486.58 5943723300 $486.58 5943723400 $486.58 5943723500 $486.58 5943723600 $486.58 5943723700 $486.58 5943723800 $486.58 5943723900 $486.58 5943724000 $486.58 5943724100 $486.58 5943724200 $486.58 5943724300 $486.58 5943724400 $486.58 5943724500 $486.58 5943724600 $486.58 5943810100 $486.58 5943810200 $486.58 5943810300 $486.58 5943810400 $486.58 5943810500 $486.58 5943810600 $486.58 5943810700 $486.58 5943810800 $486.58 5943810900 $486.58 5943811000 $486.58 5943811100 $486.58 5943811200 $486.58 5943811300 $486.58 5943811400 $486.58 5943811500 $486.58 5943811600 $486.58 5943811700 $486.58 5943811800 $486.58 5943811900 $486.58 5943812000 $486.58 5943812100 $486.58 5943812200 $486.58 5943812300 $486.58 5943812400 $486.58 5943812500 $486.58 5943812600 $486.58 5943812700 $486.58 5943812800 $486.58 5943812900 $486.58 5943820100 $486.58 5943820200 $486.58 5943820300 $486.58 5943820400 $486.58 5943820500 $486.58 5943820600 $486.58 5943820700 $486.58 5943820800 $486.58 5943820900 $486.58 5943821000 $486.58 5943821100 $486.58 5943821200 $486.58 5943821300 $486.58 5943821400 $486.58 5943821500 $486.58 5943821600 $486.58 5943821700 $486.58 5943821800 $486.58 5943821900 $486.58 5943822000 $486.58 5943822100 $486.58 5943822200 $486.58 5943822300 $486.58 5943822400 $486.58 5943822500 $486.58 5943822600 $486.58 5943822700 $486.58 5943822800 $486.58 5943822900 $486.58 5943823000 $486.58 5943823100 $486.58 5943823200 $486.58 5943823300 $486.58 5943823400 $486.58 5943823500 $486.58 5943823600 $486.58 5943823700 $486.58 5943823800 $486.58 5943823900 $486.58 5943824000 $486.58 5943824100 $486.58 5943824200 $486.58 5943830100 $486.58 Page 35 of 189 City of Chula Vista Engineer's ReportPage 250 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5943830200 $486.58 5943830300 $486.58 5943830400 $486.58 5943830500 $486.58 5943830600 $486.58 5943830700 $486.58 5943830800 $486.58 5943830900 $486.58 5943831000 $486.58 5943831100 $486.58 5943831200 $486.58 5943831300 $486.58 5943831400 $486.58 5943831500 $486.58 5943831600 $486.58 5943831700 $486.58 5943831800 $486.58 5943831900 $486.58 5943832000 $486.58 5943832100 $486.58 5943832200 $486.58 5943840100 $486.58 5943840200 $486.58 5943840300 $486.58 5943840500 $486.58 5943840600 $486.58 5943840700 $486.58 5943840800 $486.58 5943840900 $486.58 5943841000 $486.58 5943841100 $486.58 5943841200 $486.58 5943841300 $486.58 5943841400 $486.58 5943841500 $486.58 5943841600 $486.58 5943841700 $486.58 5943841800 $486.58 5943841900 $486.58 5943842000 $486.58 5943842100 $486.58 5943842200 $486.58 5943842300 $486.58 5943842400 $486.58 5943842500 $486.58 5943842600 $486.58 5943842700 $486.58 5943842800 $486.58 5943842900 $486.58 5943843000 $486.58 5943843100 $486.58 5943843200 $486.58 5943843300 $486.58 5943843400 $486.58 5943843500 $486.58 5943843600 $486.58 5943843700 $486.58 5943843800 $486.58 5943843900 $486.58 5943844000 $486.58 5943844100 $486.58 5943910100 $486.58 5943910200 $486.58 5943910300 $486.58 5943910400 $486.58 5943910500 $486.58 5943910600 $486.58 5943910700 $486.58 5943910800 $486.58 5943910900 $486.58 5943911000 $486.58 5943911100 $486.58 5943911200 $486.58 5943911300 $486.58 5943911400 $486.58 5943911500 $486.58 5943911600 $486.58 5943911700 $486.58 5943911800 $486.58 5943911900 $486.58 5943912000 $486.58 5943912100 $486.58 5943912200 $486.58 5943912300 $486.58 5943912400 $486.58 5943912500 $486.58 5943912600 $486.58 5943912700 $486.58 5943912800 $486.58 5943912900 $486.58 5943913000 $486.58 5943913100 $486.58 5943913200 $486.58 5943913300 $486.58 5943913400 $486.58 5943920100 $486.58 5943920200 $486.58 5943920300 $486.58 5943920400 $486.58 5943920500 $486.58 5943920600 $486.58 5943920700 $486.58 5943920800 $486.58 5943920900 $486.58 5943921000 $486.58 5943921100 $486.58 5943921200 $486.58 5943921300 $486.58 5943921400 $486.58 5943921500 $486.58 5943921600 $486.58 5943921700 $486.58 5943921800 $486.58 5943921900 $486.58 5943922000 $486.58 5943922100 $486.58 5943922200 $486.58 5943922300 $486.58 5943922400 $486.58 5943922500 $486.58 5943922600 $486.58 5943922700 $486.58 5943922800 $486.58 5943922900 $486.58 5943923000 $486.58 5943923100 $486.58 5943923200 $486.58 5943923300 $486.58 5943923400 $486.58 5943930100 $486.58 5943930200 $486.58 5943930300 $486.58 5943930400 $486.58 5943930500 $486.58 5943930600 $486.58 5943930700 $486.58 5943930800 $486.58 5943930900 $486.58 5943931000 $486.58 5943931100 $486.58 5943931200 $486.58 Page 36 of 189 City of Chula Vista Engineer's ReportPage 251 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-21 - OSD 14 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5943931300 $486.58 5943931400 $486.58 5943931500 $486.58 5943931600 $486.58 5943931700 $486.58 5943931800 $486.58 5943931900 $486.58 5943932000 $486.58 5943932100 $486.58 5943932200 $486.58 5943932300 $486.58 5943932400 $486.58 5943932500 $486.58 5943932600 $486.58 5943932700 $486.58 5943932800 $486.58 Totals Parcels 862 Levy $419,431.96 Page 37 of 189 City of Chula Vista Engineer's ReportPage 252 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-22 - OSD 15 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5943110100 $466.82 5943110200 $466.82 5943110300 $466.82 5943110400 $466.82 5943110500 $466.82 5943110600 $466.82 5943110700 $466.82 5943110800 $466.82 5943110900 $466.82 5943111000 $466.82 5943111100 $466.82 5943111200 $466.82 5943111300 $466.82 5943111400 $466.82 5943111500 $466.82 5943111600 $466.82 5943111700 $466.82 5943112200 $466.82 5943112300 $466.82 5943112400 $466.82 5943112500 $466.82 5943112600 $466.82 5943112700 $466.82 5943112800 $466.82 5943112900 $466.82 5943113000 $466.82 5943113100 $466.82 5943113200 $466.82 5943113300 $466.82 5943113400 $466.82 5943113500 $466.82 5943113600 $466.82 5943113700 $466.82 5943113800 $466.82 5943113900 $466.82 5943114300 $466.82 5943114400 $466.82 5943114500 $466.82 5943114600 $466.82 5943120100 $466.82 5943120200 $466.82 5943120300 $466.82 5943120400 $466.82 5943120500 $466.82 5943120600 $466.82 5943120700 $466.82 5943120800 $466.82 5943120900 $466.82 5943121000 $466.82 5943121100 $466.82 5943121200 $466.82 5943121300 $466.82 5943121400 $466.82 5943121500 $466.82 5943121600 $466.82 5943121700 $466.82 5943121800 $466.82 Totals Parcels 57 Levy $26,608.74 Assessment Roll Page 38 of 189 City of Chula Vista Engineer's ReportPage 253 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-29 - OSD 17 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6402400100 $223.46 6402400400 $223.46 6402400500 $223.46 6402400600 $223.46 6402400700 $223.46 6402400800 $223.46 6402400900 $223.46 6402401000 $223.46 6402401100 $223.46 6402401200 $223.46 6402401300 $223.46 6402401400 $223.46 6402401500 $223.46 6402401600 $223.46 6402401700 $223.46 6402401800 $223.46 6402401900 $223.46 6402402000 $223.46 6402402100 $223.46 6402402200 $223.46 6402402300 $223.46 6402402400 $223.46 6402402500 $223.46 6402402600 $223.46 6402402700 $223.46 6402402800 $223.46 6402402900 $223.46 6402403000 $223.46 6402403100 $223.46 6402403200 $223.46 6402403300 $223.46 6402403400 $223.46 6402403500 $223.46 6402403600 $223.46 6402403700 $223.46 6402403800 $223.46 6402403900 $223.46 6402404000 $223.46 6402404100 $223.46 6402404200 $223.46 6402404300 $223.46 6402404400 $223.46 6402404500 $223.46 6402404600 $223.46 6402404800 $223.46 6402404900 $223.46 Totals Parcels 46 Levy $10,279.16 Assessment Roll Page 39 of 189 City of Chula Vista Engineer's ReportPage 254 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-26 - OSD 18 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6391604800 $430.00 6391604900 $430.00 6391605000 $430.00 6391605100 $430.00 6400704000 $19,780.00 6400704201 $215.00 6400704202 $215.00 6400704203 $215.00 6400704204 $215.00 6400704205 $215.00 6400704206 $215.00 6400704207 $215.00 6400704208 $215.00 6400704209 $215.00 6400704210 $215.00 6400704211 $215.00 6400704212 $215.00 6400704213 $215.00 6400704214 $215.00 6400704215 $215.00 6400704216 $215.00 6400704217 $215.00 6400704218 $215.00 6400704219 $215.00 6400704220 $215.00 6400704221 $215.00 6400704222 $215.00 6400704223 $215.00 6400704224 $215.00 6400704225 $215.00 6400704226 $215.00 6400704227 $215.00 6400704228 $215.00 6400704229 $215.00 6400704230 $215.00 6400704231 $215.00 6400704232 $215.00 6400704233 $215.00 6400704234 $215.00 6400704235 $215.00 6400704236 $215.00 6400704237 $215.00 6400704238 $215.00 6400704239 $215.00 6400704240 $215.00 6400704241 $215.00 6400704242 $215.00 6400704243 $215.00 6400704244 $215.00 6400704245 $215.00 6400704246 $215.00 6400704247 $215.00 6400704248 $215.00 6400704249 $215.00 6400704250 $215.00 6400704251 $215.00 6400704252 $215.00 6400704253 $215.00 6400704254 $215.00 6400704255 $215.00 6400704256 $215.00 6400704257 $215.00 6400704258 $215.00 6400704259 $215.00 6400704260 $215.00 6400704261 $215.00 6400704262 $215.00 6400704263 $215.00 6400704264 $215.00 6400704301 $215.00 6400704302 $215.00 6400704303 $215.00 6400704304 $215.00 6400704305 $215.00 6400704306 $215.00 6400704307 $215.00 6400704308 $215.00 6400704309 $215.00 6400704310 $215.00 6400704311 $215.00 6400704312 $215.00 6400704313 $215.00 6400704314 $215.00 6400704315 $215.00 6400704316 $215.00 6400704317 $215.00 6400704318 $215.00 6400704319 $215.00 6400704320 $215.00 6400704321 $215.00 6400704322 $215.00 6400704323 $215.00 6400704324 $215.00 6400704325 $215.00 6400704326 $215.00 6400704327 $215.00 6400704328 $215.00 6400704329 $215.00 6400704330 $215.00 6400704331 $215.00 6400704332 $215.00 6400704333 $215.00 6400704334 $215.00 6400704335 $215.00 6400704336 $215.00 6400704337 $215.00 6400704338 $215.00 6400704339 $215.00 6400704340 $215.00 6400704341 $215.00 6400704342 $215.00 6400704343 $215.00 6400704344 $215.00 6400704345 $215.00 6400704346 $215.00 6400704347 $215.00 6400704348 $215.00 6400704349 $215.00 6400704350 $215.00 6400704351 $215.00 6400704352 $215.00 6400704353 $215.00 6400704354 $215.00 6400704355 $215.00 6400704356 $215.00 6400704357 $215.00 6400704358 $215.00 6400704359 $215.00 6400704360 $215.00 6400704361 $215.00 6400704362 $215.00 6400704363 $215.00 6400704364 $215.00 6400704365 $215.00 6400704366 $215.00 6400704401 $215.00 6400704402 $215.00 6400704403 $215.00 6400704404 $215.00 6400704405 $215.00 6400704406 $215.00 Assessment Roll Page 40 of 189 City of Chula Vista Engineer's ReportPage 255 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-26 - OSD 18 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400704407 $215.00 6400704408 $215.00 6400704409 $215.00 6400704410 $215.00 6400704411 $215.00 6400704412 $215.00 6400704413 $215.00 6400704414 $215.00 6400704415 $215.00 6400704416 $215.00 6400704417 $215.00 6400704418 $215.00 6400704419 $215.00 6400704420 $215.00 6400704421 $215.00 6400704422 $215.00 6400704423 $215.00 6400704424 $215.00 6400704425 $215.00 6400704426 $215.00 6400704427 $215.00 6400704428 $215.00 6400704429 $215.00 6400704430 $215.00 6400704431 $215.00 6400704432 $215.00 6400704433 $215.00 6400704434 $215.00 6400704435 $215.00 6400704436 $215.00 6400704437 $215.00 6400704438 $215.00 6400704439 $215.00 6400704440 $215.00 6400704441 $215.00 6400704442 $215.00 6400704443 $215.00 6400704444 $215.00 6400704445 $215.00 6400704446 $215.00 6400704447 $215.00 6400704448 $215.00 6400704449 $215.00 6400704450 $215.00 6400704451 $215.00 6400704452 $215.00 6400704453 $215.00 6400704454 $215.00 6400704455 $215.00 6400704456 $215.00 6400704457 $215.00 6400704458 $215.00 6400704459 $215.00 6400704460 $215.00 6400704461 $215.00 6400704462 $215.00 6400704463 $215.00 6400704464 $215.00 6400704465 $215.00 6400704466 $215.00 6400704467 $215.00 6400704468 $215.00 6400704469 $215.00 6400704470 $215.00 6400704471 $215.00 6400704472 $215.00 6402510100 $430.00 6402510200 $430.00 6402510300 $430.00 6402510400 $430.00 6402510500 $430.00 6402510600 $430.00 6402510700 $430.00 6402510800 $430.00 6402510900 $430.00 6402511000 $430.00 6402511100 $430.00 6402511200 $430.00 6402511300 $430.00 6402511400 $430.00 6402511500 $430.00 6402511600 $430.00 6402511700 $430.00 6402511800 $430.00 6402511900 $430.00 6402512000 $430.00 6402512100 $430.00 6402512200 $430.00 6402512300 $430.00 6402512400 $430.00 6402512500 $430.00 6402512600 $430.00 6402512700 $430.00 6402512800 $430.00 6402512900 $430.00 6402513000 $430.00 6402513100 $430.00 6402513200 $430.00 6402513300 $430.00 6402513400 $430.00 6402513500 $430.00 6402513600 $430.00 6402513700 $430.00 6402513800 $430.00 6402513900 $430.00 6402514000 $430.00 6402514100 $430.00 6402514200 $430.00 6402514300 $430.00 6402514400 $430.00 6402514500 $430.00 6402514600 $430.00 6402514700 $430.00 6402514800 $430.00 6402514900 $430.00 6402515000 $430.00 6402515100 $430.00 6402515200 $430.00 6402515300 $430.00 6402520100 $430.00 6402520200 $430.00 6402520300 $430.00 6402520400 $430.00 6402520500 $430.00 6402520600 $430.00 6402520700 $430.00 6402520800 $430.00 6402520900 $430.00 6402521000 $430.00 6402521100 $430.00 6402521200 $430.00 6402521300 $430.00 6402521400 $430.00 6402521500 $430.00 6402521600 $430.00 6402521700 $430.00 6402521800 $430.00 6402521900 $430.00 6402522000 $430.00 6402522100 $430.00 6402522200 $430.00 Page 41 of 189 City of Chula Vista Engineer's ReportPage 256 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-26 - OSD 18 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402522300 $430.00 6402522400 $430.00 6402522500 $430.00 6402522600 $430.00 6402522700 $430.00 6402522800 $430.00 6402522900 $430.00 6402523000 $430.00 6402523100 $430.00 6402523200 $430.00 6402523300 $430.00 6402523400 $430.00 6402523500 $430.00 6402523600 $430.00 6402523700 $430.00 6402523800 $430.00 6402523900 $430.00 6402524000 $430.00 6402524400 $430.00 6402524500 $430.00 6402524600 $430.00 6402524700 $430.00 6402524800 $430.00 6402524900 $430.00 6402525000 $430.00 6402525100 $430.00 6402525200 $430.00 6402525300 $430.00 6402525400 $430.00 6402525500 $430.00 6402525600 $430.00 6402525700 $430.00 6402525800 $430.00 6402525900 $430.00 6402600100 $430.00 6402600200 $430.00 6402600300 $430.00 6402600400 $430.00 6402600500 $430.00 6402600600 $430.00 6402600700 $430.00 6402600800 $430.00 6402600900 $430.00 6402601000 $430.00 6402601100 $430.00 6402601200 $430.00 6402601300 $430.00 6402601400 $430.00 6402601500 $430.00 6402601600 $430.00 6402601700 $430.00 6402601800 $430.00 6402601900 $430.00 6402602000 $430.00 6402602100 $430.00 6402602200 $430.00 6402602300 $430.00 6402602400 $430.00 6402602500 $430.00 6402602600 $430.00 6402602700 $430.00 6402602800 $430.00 6402602900 $430.00 6402603100 $430.00 6402603200 $430.00 6402603300 $430.00 6402603400 $430.00 6402603500 $430.00 6402603600 $430.00 6402603700 $430.00 6402603800 $430.00 6402603900 $430.00 6402604000 $430.00 6402604100 $430.00 6402604200 $430.00 6402604300 $430.00 6402604400 $430.00 6402604500 $430.00 6402604600 $430.00 6402604700 $430.00 6402604800 $430.00 6402604900 $430.00 6402605000 $430.00 6402605100 $430.00 6402605200 $430.00 6402605300 $430.00 6402605400 $430.00 6402605500 $430.00 6402605600 $430.00 6402605700 $430.00 6402605800 $430.00 6402605900 $430.00 6402606000 $430.00 6402606100 $430.00 6402606200 $430.00 6402606300 $430.00 6402606400 $430.00 6402606500 $430.00 6402606600 $430.00 6402606700 $430.00 6402606800 $430.00 6402606900 $430.00 6402607000 $430.00 6402607100 $430.00 6402607400 $430.00 6402710100 $430.00 6402710200 $430.00 6402710300 $430.00 6402710400 $430.00 6402710500 $430.00 6402710600 $430.00 6402710700 $430.00 6402710800 $430.00 6402710900 $430.00 6402711000 $430.00 6402711100 $430.00 6402711200 $430.00 6402711300 $430.00 6402711400 $430.00 6402711500 $430.00 6402711600 $430.00 6402711700 $430.00 6402711800 $430.00 6402711900 $430.00 6402712000 $430.00 6402712100 $430.00 6402712200 $430.00 6402712300 $430.00 6402712400 $430.00 6402712500 $430.00 6402712600 $430.00 6402712700 $430.00 6402712800 $430.00 6402712900 $430.00 6402713000 $430.00 6402713100 $430.00 6402713200 $430.00 6402713300 $430.00 6402713400 $430.00 6402713500 $430.00 6402713600 $430.00 Page 42 of 189 City of Chula Vista Engineer's ReportPage 257 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-26 - OSD 18 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402713700 $430.00 6402713800 $430.00 6402713900 $430.00 6402714000 $430.00 6402714100 $430.00 6402714200 $430.00 6402714300 $430.00 6402714400 $430.00 6402714500 $430.00 6402714600 $430.00 6402714700 $430.00 6402714800 $430.00 6402714900 $430.00 6402715000 $430.00 6402715100 $430.00 6402715200 $430.00 6402715300 $430.00 6402715400 $430.00 6402715500 $430.00 6402715600 $430.00 6402720100 $430.00 6402720200 $430.00 6402720300 $430.00 6402720400 $430.00 6402720500 $430.00 6402720600 $430.00 6402720700 $430.00 6402720800 $430.00 6402720900 $430.00 6402721000 $430.00 6402721100 $430.00 6402721200 $430.00 6402721300 $430.00 6402721400 $430.00 6402721500 $430.00 6402721600 $430.00 6402721700 $430.00 6402721800 $430.00 6402721900 $430.00 6402722000 $430.00 6402722100 $430.00 6402722200 $430.00 6402722300 $430.00 6402722400 $430.00 6402722500 $430.00 6402722600 $430.00 6402722700 $430.00 6402722800 $430.00 6402722900 $430.00 6402723000 $430.00 6402723100 $430.00 6402723200 $430.00 6402723300 $430.00 6402723400 $430.00 6402723500 $430.00 6402723600 $430.00 6402723700 $430.00 6402723800 $430.00 6402723900 $430.00 6402724000 $430.00 6402724100 $430.00 6402724200 $430.00 6402724300 $430.00 6402724400 $430.00 6402724500 $430.00 6402724600 $430.00 6402724700 $430.00 6402724800 $430.00 6402724900 $430.00 Totals Parcels 492 Levy $187,480.00 Page 43 of 189 City of Chula Vista Engineer's ReportPage 258 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5931410100 $11.42 5931410200 $11.42 5931410300 $11.42 5931410400 $11.42 5931410500 $11.42 5931410600 $11.42 5931410700 $11.42 5931410800 $11.42 5931410900 $11.42 5931411000 $11.42 5931411100 $11.42 5931411200 $11.42 5931411300 $11.42 5931411400 $11.42 5931411500 $11.42 5931411600 $11.42 5931411700 $11.42 5931411800 $11.42 5931411900 $11.42 5931412000 $11.42 5931412100 $11.42 5931420100 $11.42 5931420200 $11.42 5931420300 $11.42 5931420400 $11.42 5931420500 $11.42 5931420600 $11.42 5931420700 $11.42 5931420800 $11.42 5931420900 $11.42 5931421000 $11.42 5931421100 $11.42 5931421200 $11.42 5931421300 $11.42 5931421400 $11.42 5931421500 $11.42 5931421600 $11.42 5931421700 $11.42 5931421800 $11.42 5931421900 $11.42 5931422000 $11.42 5931422100 $11.42 5931422200 $11.42 5931422300 $11.42 5931422400 $11.42 5931422500 $11.42 5931422600 $11.42 5931422700 $11.42 5931422800 $11.42 5931422900 $11.42 5931423000 $11.42 5931423100 $11.42 5931423200 $11.42 5931423300 $11.42 5931423400 $11.42 5931423500 $11.42 5931430100 $11.42 5931430300 $11.42 5931430400 $11.42 5931430500 $11.42 5931430600 $11.42 5931430700 $11.42 5931430800 $11.42 5931430900 $11.42 5931431000 $11.42 5931431100 $11.42 5931431200 $11.42 5931431300 $11.42 5931431400 $11.42 5931431500 $11.42 5931431600 $11.42 5931431700 $11.42 5931431800 $11.42 5931431900 $11.42 5931432000 $11.42 5931432100 $11.42 5931432200 $11.42 5931432600 $11.42 5933700100 $26.92 5933700200 $26.92 5933700300 $26.92 5933700400 $26.92 5933700500 $26.92 5933700600 $26.92 5933700700 $26.92 5933700800 $26.92 5933700900 $26.92 5933701000 $26.92 5933701100 $26.92 5933701200 $26.92 5933701300 $26.92 5933701400 $26.92 5933701500 $26.92 5933701600 $26.92 5933701700 $26.92 5933701800 $26.92 5933701900 $26.92 5933702000 $26.92 5933702100 $26.92 5933702200 $26.92 5933702300 $26.92 5933702400 $26.92 5933702500 $26.92 5933702600 $26.92 5933702700 $26.92 5933702800 $26.92 5933702900 $26.92 5933703000 $26.92 5933703100 $26.92 5933703200 $26.92 5933703300 $26.92 5933703400 $26.92 5933703500 $26.92 5933703600 $26.92 5933703700 $26.92 5933703800 $26.92 5933703900 $26.92 5933704000 $26.92 5933704100 $26.92 5933704200 $26.92 5933704300 $26.92 5933704400 $26.92 5933704500 $26.92 5933704600 $26.92 5933704700 $26.92 5933704800 $26.92 5933710100 $26.92 5933710200 $26.92 5933710300 $26.92 5933710400 $26.92 5933710500 $26.92 5933710600 $26.92 5933710700 $26.92 5933710800 $26.92 5933710900 $26.92 5933711000 $26.92 5933711100 $26.92 5933711200 $26.92 5933711300 $26.92 5933711400 $26.92 5933711500 $26.92 Assessment Roll Page 44 of 189 City of Chula Vista Engineer's ReportPage 259 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933711600 $26.92 5933711700 $26.92 5933711800 $26.92 5933711900 $26.92 5933712000 $26.92 5933712100 $26.92 5933712200 $26.92 5933712300 $26.92 5933712400 $26.92 5933712500 $26.92 5933712600 $26.92 5933712700 $26.92 5933712800 $26.92 5933712900 $26.92 5933713000 $26.92 5933713100 $26.92 5933713200 $26.92 5933713300 $26.92 5933713400 $26.92 5933713500 $26.92 5933713600 $26.92 5933713700 $26.92 5933713800 $26.92 5933713900 $26.92 5933714000 $26.92 5933714100 $26.92 5933714200 $26.92 5933714300 $26.92 5933714400 $26.92 5933714500 $26.92 5933714600 $26.92 5933714700 $26.92 5933714800 $26.92 5933714900 $26.92 5933715000 $26.92 5933715100 $26.92 5933715200 $26.92 5933715300 $26.92 5933715400 $26.92 5933715500 $26.92 5933715600 $26.92 5933715700 $26.92 5933715800 $26.92 5933715900 $26.92 5933716000 $26.92 5933716100 $26.92 5933716200 $26.92 5933716300 $26.92 5933716400 $26.92 5933716500 $26.92 5933716600 $26.92 5933716700 $26.92 5933716800 $26.92 5933716900 $26.92 5933717000 $26.92 5933717100 $26.92 5933717200 $26.92 5933717300 $26.92 5933717500 $26.92 5933717600 $26.92 5933717700 $26.92 5933717800 $26.92 5933717900 $26.92 5933718000 $26.92 5933718100 $26.92 5933718200 $26.92 5933718300 $26.92 5933718400 $26.92 5933718500 $26.92 5933720100 $26.92 5933720200 $26.92 5933720300 $26.92 5933720400 $26.92 5933720500 $26.92 5933720600 $26.92 5933720700 $26.92 5933720800 $26.92 5933720900 $26.92 5933721000 $26.92 5933721100 $26.92 5933721200 $26.92 5933721300 $26.92 5933721400 $26.92 5933721500 $26.92 5933721600 $26.92 5933721700 $26.92 5933721800 $26.92 5933721900 $26.92 5933722000 $26.92 5933722100 $26.92 5933722200 $26.92 5933722300 $26.92 5933722400 $26.92 5933722500 $26.92 5933722600 $26.92 5933722700 $26.92 5933722800 $26.92 5933722900 $26.92 5933723000 $26.92 5933723100 $26.92 5933723200 $26.92 5933723300 $26.92 5933723400 $26.92 5933723500 $26.92 5933723600 $26.92 5933730100 $26.92 5933730200 $26.92 5933730300 $26.92 5933730400 $26.92 5933730500 $26.92 5933730600 $26.92 5933730700 $26.92 5933730800 $26.92 5933730900 $26.92 5933731000 $26.92 5933731100 $26.92 5933731200 $26.92 5933731300 $26.92 5933731400 $26.92 5933731500 $26.92 5933731600 $26.92 5933731700 $26.92 5933731800 $26.92 5933731900 $26.92 5933732000 $26.92 5933732100 $26.92 5933732200 $26.92 5933732300 $26.92 5933732400 $26.92 5933732500 $26.92 5933732600 $26.92 5933732700 $26.92 5933732800 $26.92 5933732900 $26.92 5933733000 $26.92 5933733100 $26.92 5933733200 $26.92 5933733300 $26.92 5933733400 $26.92 5933733500 $26.92 5933733600 $26.92 Page 45 of 189 City of Chula Vista Engineer's ReportPage 260 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933733700 $26.92 5933733800 $26.92 5933733900 $26.92 5933734000 $26.92 5933734100 $26.92 5933734200 $26.92 5933734300 $26.92 5933734400 $26.92 5933734500 $26.92 5933734600 $26.92 5933734700 $26.92 5933734800 $26.92 5933734900 $26.92 5933735000 $26.92 5933735100 $26.92 5933735200 $26.92 5933735300 $26.92 5933735400 $26.92 5933735500 $26.92 5933735600 $26.92 5933735700 $26.92 5933735800 $26.92 5933802500 $26.92 5933802600 $26.92 5933802700 $26.92 5933802800 $26.92 5933802900 $26.92 5933810400 $26.92 5933810500 $26.92 5933810600 $26.92 5933810700 $26.92 5933810800 $26.92 5933810900 $26.92 5933811000 $26.92 5933811100 $26.92 5933811200 $26.92 5933811300 $26.92 5933811400 $26.92 5933811500 $26.92 5933811600 $26.92 5933811700 $26.92 5933811800 $26.92 5933811900 $26.92 5933812000 $26.92 5933812100 $26.92 5933812200 $26.92 5933812300 $26.92 5933812400 $26.92 5933812500 $26.92 5933812600 $26.92 5933812700 $26.92 5933812800 $26.92 5933812900 $26.92 5933813000 $26.92 5933813100 $26.92 5933813200 $26.92 5933813300 $26.92 5933813400 $26.92 5933813500 $26.92 5933813600 $26.92 5933813700 $26.92 5933820100 $26.92 5933820200 $26.92 5933820300 $26.92 5933820400 $26.92 5933820500 $26.92 5933820600 $26.92 5933820700 $26.92 5933820800 $26.92 5933820900 $26.92 5933821000 $26.92 5933821100 $26.92 5933821200 $26.92 5933821300 $26.92 5933821400 $26.92 5933821500 $26.92 5933821600 $26.92 5933821700 $26.92 5933821800 $26.92 5933821900 $26.92 5933822000 $26.92 5933822100 $26.92 5933822200 $26.92 5933822300 $26.92 5933822400 $26.92 5933822500 $26.92 5933822600 $26.92 5933822700 $26.92 5933822800 $26.92 5933822900 $26.92 5933823000 $26.92 5933823100 $26.92 5933823200 $26.92 5933823300 $26.92 5933823400 $26.92 5933823500 $26.92 5933823600 $26.92 5933823700 $26.92 5933823800 $475.66 5933824000 $25.28 5933824100 $90.56 5934000100 $81.58 5934000200 $81.58 5934000300 $81.58 5934000400 $81.58 5934000900 $81.58 5934001000 $81.58 5934001100 $81.58 5934001200 $81.58 5934001300 $81.58 5934001400 $81.58 5934001500 $81.58 5934001600 $81.58 5934001700 $81.58 5934001800 $81.58 5934001900 $81.58 5934010100 $81.58 5934011600 $81.58 5934011700 $81.58 5934011800 $81.58 5934011900 $81.58 5934012000 $81.58 5934012100 $81.58 5934012200 $81.58 5934012300 $81.58 5934012400 $81.58 5934012500 $81.58 5934012600 $81.58 5934012700 $81.58 5934012800 $81.58 5934012900 $81.58 5934013000 $81.58 5934013100 $81.58 5934013200 $81.58 5934013300 $81.58 5934013400 $81.58 5934013500 $81.58 5934013600 $81.58 5941210100 $11.42 5941210200 $11.42 5941210300 $11.42 Page 46 of 189 City of Chula Vista Engineer's ReportPage 261 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5941210400 $11.42 5941210500 $11.42 5941210600 $11.42 5941210700 $11.42 5941210800 $11.42 5941210900 $11.42 5941211000 $11.42 5941211100 $11.42 5941211200 $11.42 5941211300 $11.42 5941211400 $11.42 5941211500 $11.42 5941211600 $11.42 5941211700 $11.42 5941211800 $11.42 5941211900 $11.42 5941212000 $11.42 5941212100 $11.42 5941212200 $11.42 5941212300 $11.42 5941212700 $11.42 5941212800 $11.42 5941212900 $11.42 5941213000 $11.42 5941213100 $11.42 5941213200 $11.42 5941213300 $11.42 5941213400 $11.42 5941213500 $11.42 5941213600 $11.42 5941213700 $11.42 5941213800 $11.42 5941213900 $11.42 5941214000 $11.42 5941214100 $11.42 5941214200 $11.42 5941214300 $11.42 5941214400 $11.42 5941214500 $11.42 5941214600 $11.42 5941214700 $11.42 5941214800 $11.42 5941214900 $11.42 5941215000 $11.42 5941215100 $11.42 5941215200 $11.42 5941215300 $11.42 5941215400 $11.42 5941215500 $11.42 5941215600 $11.42 5941215700 $11.42 5941215800 $11.42 5941215900 $11.42 5941216000 $11.42 5941216100 $11.42 5941216200 $11.42 5941216300 $11.42 5941216400 $11.42 5941216500 $11.42 5941216600 $11.42 5941216700 $11.42 5941216800 $11.42 5941216900 $11.42 5941217000 $11.42 5941217100 $11.42 5941217200 $11.42 5941217300 $11.42 5941217400 $11.42 5941217500 $11.42 5941217600 $11.42 5941217700 $11.42 5941218200 $11.42 5941218300 $11.42 5941218400 $11.42 5941220100 $26.92 5941220200 $26.92 5941220300 $26.92 5941220400 $26.92 5941220500 $26.92 5941220600 $26.92 5941220700 $26.92 5941220800 $26.92 5941220900 $26.92 5941221000 $26.92 5941221100 $26.92 5941221200 $26.92 5941221300 $26.92 5941221400 $26.92 5941221500 $26.92 5941221600 $26.92 5941221700 $26.92 5941221800 $26.92 5941221900 $26.92 5941222000 $26.92 5941222100 $26.92 5941222200 $26.92 5941222300 $26.92 5941222400 $26.92 5941222500 $26.92 5941222600 $26.92 5941222700 $26.92 5941222800 $26.92 5941222900 $26.92 5941223000 $26.92 5941223100 $26.92 5941223200 $26.92 5941223300 $26.92 5941223400 $26.92 5941223500 $26.92 5941223600 $26.92 5941223700 $26.92 5941223800 $26.92 5941223900 $26.92 5941224000 $26.92 5941224100 $26.92 5941224200 $26.92 5941224300 $26.92 5941224400 $26.92 5941224500 $26.92 5941224600 $26.92 5941224700 $26.92 5941224800 $26.92 5941224900 $26.92 5941225000 $26.92 5941225100 $26.92 5941225200 $26.92 5941225300 $26.92 5941225400 $26.92 5941225500 $26.92 5941225600 $26.92 5941225700 $26.92 5941225800 $26.92 5941225900 $26.92 5941226000 $26.92 5941226100 $26.92 5941226200 $26.92 5941226300 $26.92 5941226400 $26.92 5941226500 $26.92 5941226600 $26.92 5941226700 $26.92 Page 47 of 189 City of Chula Vista Engineer's ReportPage 262 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5941226800 $26.92 5944300100 $16.30 5944300200 $16.30 5944300300 $16.30 5944300400 $16.30 5944300500 $16.30 5944300600 $16.30 5944300700 $16.30 5944300800 $16.30 5944300900 $16.30 5944301000 $16.30 5944301100 $16.30 5944301200 $16.30 5944301300 $16.30 5944301400 $16.30 5944301500 $16.30 5944301600 $16.30 5944301700 $16.30 5944301800 $16.30 5944301900 $16.30 5944302000 $16.30 5944302100 $16.30 5944302200 $16.30 5944302300 $16.30 5944302400 $16.30 5944302500 $16.30 5944302600 $16.30 5944302700 $16.30 5944302800 $16.30 5944302900 $16.30 5944303000 $16.30 5944303100 $16.30 5944303200 $16.30 5944303300 $16.30 5944303400 $16.30 5944303500 $16.30 5944303600 $16.30 5944303700 $16.30 5944303800 $16.30 5944303900 $16.30 5944304000 $16.30 5944304100 $16.30 5944304200 $16.30 5944304300 $16.30 5944304400 $16.30 5944304500 $16.30 5944304600 $16.30 5944304700 $16.30 5944304800 $16.30 5944304900 $16.30 5944305000 $16.30 5944305100 $16.30 5944305200 $16.30 5944305300 $16.30 5944305400 $16.30 5944305500 $16.30 5944305600 $16.30 5944305700 $16.30 5944305800 $16.30 5944305900 $16.30 5944306000 $16.30 5944306100 $16.30 5944306200 $16.30 5944306300 $16.30 5944310100 $16.30 5944310200 $16.30 5944310300 $16.30 5944310400 $16.30 5944310500 $16.30 5944310600 $16.30 5944310700 $16.30 5944310800 $16.30 5944310900 $16.30 5944311000 $16.30 5944311100 $16.30 5944311200 $16.30 5944311300 $16.30 5944311400 $16.30 5944311500 $16.30 5944311600 $16.30 5944311700 $16.30 5944311800 $16.30 5944311900 $16.30 5944312000 $16.30 5944312100 $16.30 5944312200 $16.30 5944312300 $16.30 5944312400 $16.30 5944312500 $16.30 5944312600 $16.30 5944312700 $16.30 5944312800 $16.30 5944312900 $16.30 5944313000 $16.30 5944313100 $16.30 5944313200 $16.30 5944313300 $16.30 5944313400 $16.30 5944313500 $16.30 5944313600 $16.30 5944313700 $16.30 5944313800 $16.30 5944313900 $16.30 5944314000 $16.30 5944314100 $16.30 5944314200 $16.30 5944314300 $16.30 5944314400 $16.30 5944314500 $16.30 5944314600 $16.30 5944314700 $16.30 5944314800 $16.30 5944320200 $16.30 5944320300 $16.30 5944320400 $16.30 5944320500 $16.30 5944320600 $16.30 5944320700 $16.30 5944320800 $16.30 5944320900 $16.30 5944321000 $16.30 5944321100 $16.30 5944321200 $16.30 5944321300 $16.30 5944321400 $16.30 5944321500 $16.30 5944321600 $16.30 5944321700 $16.30 5944321800 $16.30 5944321900 $16.30 5944322000 $16.30 5944322100 $16.30 5944322200 $16.30 5944322300 $16.30 5944322400 $16.30 5944322500 $16.30 5944322600 $16.30 5944322700 $16.30 5944322800 $16.30 5944322900 $16.30 5944323000 $16.30 Page 48 of 189 City of Chula Vista Engineer's ReportPage 263 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944323100 $16.30 5944323200 $16.30 5944323300 $16.30 5944323400 $16.30 5944323500 $16.30 5944323600 $16.30 5944323700 $16.30 5944323800 $16.30 5944323900 $16.30 5944324000 $16.30 5944324100 $16.30 5944324200 $16.30 5944324300 $16.30 5944324400 $16.30 5944324500 $16.30 5944324600 $16.30 5944324700 $16.30 5944324800 $16.30 5944324900 $16.30 5944325000 $16.30 5944325100 $16.30 5944325200 $16.30 5944325300 $16.30 5944325400 $16.30 5944325500 $16.30 5944325600 $16.30 5944325700 $16.30 5944325800 $16.30 5944325900 $16.30 5944326000 $16.30 5944326100 $16.30 5944326200 $16.30 5944326300 $16.30 5944326400 $16.30 5944326500 $16.30 5944326600 $16.30 5944326700 $16.30 5944326800 $16.30 5944326900 $16.30 5944327000 $16.30 5944327100 $16.30 5944327200 $16.30 5944327300 $16.30 5944327400 $16.30 5944327500 $16.30 5944327600 $16.30 5944327700 $16.30 5944327800 $16.30 5944327900 $16.30 5944328000 $16.30 5944328100 $16.30 5944328200 $16.30 5944328300 $16.30 5944328400 $16.30 5944328500 $16.30 5944328600 $16.30 5944328700 $16.30 5944330100 $16.30 5944330200 $16.30 5944330300 $16.30 5944330400 $16.30 5944330500 $16.30 5944330600 $16.30 5944330700 $16.30 5944330800 $16.30 5944330900 $16.30 5944331000 $16.30 5944331100 $16.30 5944331200 $16.30 5944331300 $16.30 5944331400 $16.30 5944331500 $16.30 5944331600 $16.30 5944331700 $16.30 5944331800 $16.30 5944331900 $16.30 5944332000 $16.30 5944332100 $16.30 5944332200 $16.30 5944332300 $16.30 5944332400 $16.30 5944332500 $16.30 5944332600 $16.30 5944332700 $16.30 5944332800 $16.30 5944332900 $16.30 5944333000 $16.30 5944333100 $16.30 5944333300 $16.30 5944333400 $16.30 5944333500 $16.30 5944333600 $16.30 5944333700 $16.30 5944333800 $16.30 5944333900 $16.30 5944334000 $16.30 5944334100 $16.30 5944334200 $16.30 5944334300 $16.30 5944334400 $16.30 5944334500 $16.30 5944334600 $16.30 5944334700 $16.30 5944334800 $16.30 5944334900 $16.30 5944335000 $16.30 5944335100 $16.30 5944335200 $16.30 5944335300 $16.30 5944335400 $16.30 5944335500 $16.30 5944335600 $16.30 5944335700 $16.30 5944335800 $16.30 5944335900 $16.30 5944336000 $16.30 5944336100 $16.30 5944336200 $16.30 5944336300 $16.30 5944336400 $16.30 5944336500 $16.30 5944336600 $16.30 5944336700 $16.30 5944336800 $16.30 5944336900 $16.30 5944337000 $16.30 5944337100 $16.30 5944337200 $16.30 5944337300 $16.30 5944337400 $16.30 5944337800 $16.30 6400210100 $16.30 6400210200 $16.30 6400210300 $16.30 6400210400 $16.30 6400210500 $16.30 6400210600 $16.30 6400210700 $16.30 6400210800 $16.30 6400211000 $16.30 6400211100 $16.30 Page 49 of 189 City of Chula Vista Engineer's ReportPage 264 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400211200 $16.30 6400211300 $16.30 6400211700 $16.30 6400211800 $16.30 6400211900 $16.30 6400212000 $16.30 6400212100 $16.30 6400212200 $16.30 6400212300 $16.30 6400212400 $16.30 6400212500 $16.30 6400212600 $16.30 6400212700 $16.30 6400212800 $16.30 6400212900 $16.30 6400213000 $16.30 6400213100 $16.30 6400213200 $16.30 6400213300 $16.30 6400213400 $16.30 6400213500 $16.30 6400213600 $16.30 6400213700 $16.30 6400213800 $16.30 6400213900 $16.30 6400214000 $16.30 6400214100 $16.30 6400214200 $16.30 6400214300 $16.30 6400214400 $16.30 6400214500 $16.30 6400214600 $16.30 6400214700 $16.30 6400214800 $16.30 6400214900 $16.30 6400215000 $16.30 6400215100 $16.30 6400215200 $16.30 6400215300 $16.30 6400215400 $16.30 6400215500 $16.30 6400215600 $16.30 6400215700 $16.30 6400215800 $16.30 6400215900 $16.30 6400216000 $16.30 6400216100 $16.30 6400216200 $16.30 6400220100 $16.30 6400220200 $16.30 6400220300 $16.30 6400220400 $16.30 6400220500 $16.30 6400220600 $16.30 6400220700 $16.30 6400220800 $16.30 6400220900 $16.30 6400221000 $16.30 6400221100 $16.30 6400221200 $16.30 6400221300 $16.30 6400221400 $16.30 6400221500 $16.30 6400221600 $16.30 6400221700 $16.30 6400221800 $16.30 6400221900 $16.30 6400222000 $16.30 6400222100 $16.30 6400222200 $16.30 6400222300 $16.30 6400222400 $16.30 6400222500 $16.30 6400222600 $16.30 6400222700 $16.30 6400222800 $16.30 6400222900 $16.30 6400223000 $16.30 6400223100 $16.30 6400223200 $16.30 6400223300 $16.30 6400223400 $16.30 6400223500 $16.30 6400223600 $16.30 6400223700 $16.30 6400223800 $16.30 6400223900 $16.30 6400224000 $16.30 6400224100 $16.30 6400224200 $16.30 6400224300 $16.30 6400224400 $16.30 6400224500 $16.30 6400224600 $16.30 6400224700 $16.30 6400224800 $16.30 6400224900 $16.30 6400225000 $16.30 6400225100 $16.30 6400225200 $16.30 6400225300 $16.30 6400225400 $16.30 6400225500 $16.30 6400225600 $16.30 6400225700 $16.30 6400225800 $16.30 6400225900 $16.30 6400226000 $16.30 6400230100 $16.30 6400230200 $16.30 6400230300 $16.30 6400230400 $16.30 6400230500 $16.30 6400230600 $16.30 6400230700 $16.30 6400230800 $16.30 6400230900 $16.30 6400231000 $16.30 6400231100 $16.30 6400231200 $16.30 6400231300 $16.30 6400231400 $16.30 6400231500 $16.30 6400231600 $16.30 6400231700 $16.30 6400231800 $16.30 6400231900 $16.30 6400232000 $16.30 6400232100 $16.30 6400232200 $16.30 6400232300 $16.30 6400232400 $16.30 6400232500 $16.30 6400232600 $16.30 6400232700 $16.30 6400232800 $16.30 6400232900 $16.30 6400233000 $16.30 6400233100 $16.30 6400233200 $16.30 6400233300 $16.30 Page 50 of 189 City of Chula Vista Engineer's ReportPage 265 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400233400 $16.30 6400233500 $16.30 6400233600 $16.30 6400233700 $16.30 6400233800 $16.30 6400233900 $16.30 6400234000 $16.30 6400234100 $16.30 6400234200 $16.30 6400234300 $16.30 6400234400 $16.30 6400234500 $16.30 6400234600 $16.30 6400234700 $16.30 6400310100 $26.92 6400310200 $26.92 6400310300 $26.92 6400310400 $26.92 6400310500 $26.92 6400310600 $26.92 6400310700 $26.92 6400310800 $26.92 6400310900 $26.92 6400311000 $26.92 6400311100 $26.92 6400311200 $26.92 6400311300 $26.92 6400311400 $26.92 6400311500 $26.92 6400311600 $26.92 6400311700 $26.92 6400311800 $26.92 6400311900 $26.92 6400312000 $26.92 6400312100 $26.92 6400312200 $26.92 6400312300 $26.92 6400312400 $26.92 6400312500 $26.92 6400312600 $26.92 6400312700 $26.92 6400312800 $26.92 6400312900 $26.92 6400313000 $26.92 6400313100 $26.92 6400313200 $26.92 6400313300 $26.92 6400313400 $26.92 6400313500 $26.92 6400313600 $26.92 6400313700 $26.92 6400313800 $26.92 6400313900 $26.92 6400314000 $26.92 6400314100 $26.92 6400314200 $26.92 6400314300 $26.92 6400314400 $26.92 6400314500 $26.92 6400314600 $26.92 6400314700 $26.92 6400314800 $26.92 6400314900 $26.92 6400315000 $26.92 6400315100 $26.92 6400315200 $26.92 6400315300 $26.92 6400315400 $26.92 6400315500 $26.92 6400320100 $26.92 6400320200 $26.92 6400320300 $26.92 6400320400 $26.92 6400320500 $26.92 6400320600 $26.92 6400320700 $26.92 6400320800 $26.92 6400320900 $26.92 6400321000 $26.92 6400321100 $26.92 6400321200 $26.92 6400321300 $26.92 6400321400 $26.92 6400321500 $26.92 6400321800 $26.92 6400321900 $26.92 6400322000 $26.92 6400322100 $26.92 6400322200 $26.92 6400322300 $26.92 6400322400 $26.92 6400322500 $26.92 6400322600 $26.92 6400322700 $26.92 6400322800 $26.92 6400322900 $26.92 6400323000 $26.92 6400323100 $26.92 6400323200 $26.92 6400323300 $26.92 6400323400 $26.92 6400323500 $26.92 6400323600 $26.92 6400323700 $26.92 6400323800 $26.92 6400323900 $26.92 6400324000 $26.92 6400324100 $26.92 6400324200 $26.92 6400324300 $26.92 6400324400 $26.92 6400324500 $26.92 6400324600 $26.92 6400324700 $26.92 6400324800 $26.92 6400324900 $26.92 6400325000 $26.92 6400325100 $26.92 6400325200 $26.92 6400325300 $26.92 6400325400 $26.92 6400325500 $26.92 6400325600 $26.92 6400325700 $26.92 6400325800 $26.92 6400325900 $26.92 6400326300 $26.92 6400326400 $26.92 6400330100 $26.92 6400330200 $26.92 6400330300 $26.92 6400330400 $26.92 6400330500 $26.92 6400330600 $26.92 6400330700 $26.92 6400330800 $26.92 6400330900 $26.92 6400331000 $26.92 6400331100 $26.92 6400331200 $26.92 6400331300 $26.92 Page 51 of 189 City of Chula Vista Engineer's ReportPage 266 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400331400 $26.92 6400331500 $26.92 6400331600 $26.92 6400331700 $26.92 6400331800 $26.92 6400331900 $26.92 6400332000 $26.92 6400332100 $26.92 6400332200 $26.92 6400332300 $26.92 6400332400 $26.92 6400332500 $26.92 6400332600 $26.92 6400332700 $26.92 6400332800 $26.92 6400332900 $26.92 6400333000 $26.92 6400333100 $26.92 6400333200 $26.92 6400333300 $26.92 6400333400 $26.92 6400333500 $26.92 6400333600 $26.92 6400333700 $26.92 6400333800 $26.92 6400333900 $26.92 6400334000 $26.92 6400334100 $26.92 6400334200 $26.92 6400334300 $26.92 6400334400 $26.92 6400334500 $26.92 6400334600 $26.92 6400334700 $26.92 6400334800 $26.92 6400334900 $26.92 6400335000 $26.92 6400335100 $26.92 6400335200 $26.92 6400335300 $26.92 6400335400 $26.92 6400335500 $26.92 6400335600 $26.92 6400335700 $26.92 6400335800 $26.92 6400335900 $26.92 6400336000 $26.92 6400336100 $26.92 6402910400 $178.66 6402910500 $132.16 6402910600 $222.72 6402911300 $1,647.28 6402921900 $222.72 6402922000 $526.24 6402923600 $1,400.06 6402923900 $148.48 6402924000 $117.48 6402924400 $46.50 6402924600 $463.42 6402924700 $122.38 6402924800 $122.38 6402925000 $1,727.22 6402925200 $226.40 6402925300 $90.56 6402930300 $308.40 6402930400 $373.66 6402930600 $126.46 6402931200 $136.24 6402931500 $169.70 6402931600 $107.68 6402931700 $93.00 6402932300 $440.58 6402932600 $155.00 6402932700 $319.82 6402932800 $450.36 6402933100 $366.32 6402933201 $9.14 6402933202 $9.14 6402933203 $9.14 6402933204 $9.14 6402933205 $9.14 6402933206 $9.14 6402933207 $9.14 6402933208 $9.14 6402933209 $9.14 6402933210 $9.14 6402933211 $9.14 6402933212 $9.14 6402933213 $9.14 6402933214 $9.14 6402933215 $9.14 6402933216 $9.14 6402933217 $9.14 6402933218 $9.14 6403100100 $16.30 6403100200 $16.30 6403100300 $16.30 6403100400 $16.30 6403100500 $16.30 6403100600 $16.30 6403100700 $16.30 6403100800 $16.30 6403100900 $16.30 6403101000 $16.30 6403101100 $16.30 6403101200 $16.30 6403101300 $16.30 6403101400 $16.30 6403101500 $16.30 6403101600 $16.30 6403101700 $16.30 6403101800 $16.30 6403101900 $16.30 6403102000 $16.30 6403102100 $16.30 6403102200 $16.30 6403102300 $16.30 6403102400 $16.30 6403102500 $16.30 6403102600 $16.30 6403102700 $16.30 6403102800 $16.30 6403102900 $16.30 6403103000 $16.30 6403103100 $16.30 6403103200 $16.30 6403103300 $16.30 6403103400 $16.30 6403103500 $16.30 6403103600 $16.30 6403103700 $16.30 6403103800 $16.30 6403103900 $16.30 6403104000 $16.30 6403104100 $16.30 6403104200 $16.30 6403104300 $16.30 6403104400 $16.30 6403104500 $16.30 6403104600 $16.30 6403104700 $16.30 Page 52 of 189 City of Chula Vista Engineer's ReportPage 267 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403104800 $16.30 6403104900 $16.30 6403105000 $16.30 6403105100 $16.30 6403105200 $16.30 6403105300 $16.30 6403105400 $16.30 6403105500 $16.30 6403105600 $16.30 6403105700 $16.30 6403105800 $16.30 6403105900 $16.30 6403106000 $16.30 6403106100 $16.30 6403106200 $16.30 6403106300 $16.30 6403106400 $16.30 6403106500 $16.30 6403106600 $16.30 6403106700 $16.30 6403106800 $16.30 6403106900 $16.30 6403107000 $16.30 6403107100 $16.30 6403107200 $16.30 6403107300 $16.30 6403107400 $16.30 6403107500 $16.30 6403107600 $16.30 6403107700 $16.30 6403107800 $16.30 6403107900 $16.30 6403108000 $16.30 6403108100 $16.30 6403108200 $16.30 6403108300 $16.30 6403108400 $16.30 6403108500 $16.30 6403108600 $16.30 6403108700 $16.30 6403108800 $16.30 6403108900 $16.30 6403109000 $16.30 6403109100 $16.30 6403110100 $16.30 6403110200 $16.30 6403110300 $16.30 6403110400 $16.30 6403110500 $16.30 6403110600 $16.30 6403110700 $16.30 6403110800 $16.30 6403110900 $16.30 6403111000 $16.30 6403111100 $16.30 6403111200 $16.30 6403111300 $16.30 6403111400 $16.30 6403111500 $16.30 6403111600 $16.30 6403111700 $16.30 6403111800 $16.30 6403111900 $16.30 6403112000 $16.30 6403112100 $16.30 6403112200 $16.30 6403112300 $16.30 6403112400 $16.30 6403112500 $16.30 6403112600 $16.30 6403112700 $16.30 6403112800 $16.30 6403112900 $16.30 6403113000 $16.30 6403113100 $16.30 6403113200 $16.30 6403113300 $16.30 6403113400 $16.30 6403113500 $16.30 6403113600 $16.30 6403113700 $16.30 6403113800 $16.30 6403113900 $16.30 6403114000 $16.30 6403114100 $16.30 6403114200 $16.30 6403114300 $16.30 6403114400 $16.30 6403114500 $16.30 6403114600 $16.30 6403114700 $16.30 6403114800 $16.30 6403114900 $16.30 6403115000 $16.30 6403115100 $16.30 6403115200 $16.30 6403115300 $16.30 6403115400 $16.30 6403115500 $16.30 6403115600 $16.30 6403115700 $16.30 6403115800 $16.30 6403115900 $16.30 6403116000 $16.30 6403116100 $16.30 6403116200 $16.30 6403116300 $16.30 6403116400 $16.30 6403116500 $16.30 6403116600 $16.30 6403116700 $16.30 6403116800 $16.30 6403116900 $16.30 6403117000 $16.30 6403117100 $16.30 6403117200 $16.30 6403117300 $16.30 6403117400 $16.30 6403117500 $16.30 6403117600 $16.30 6403210100 $16.30 6403210200 $16.30 6403210300 $16.30 6403210400 $16.30 6403210500 $16.30 6403210600 $16.30 6403210700 $16.30 6403210800 $16.30 6403210900 $16.30 6403211000 $16.30 6403211100 $16.30 6403211200 $16.30 6403211300 $16.30 6403211400 $16.30 6403211500 $16.30 6403211600 $16.30 6403211700 $16.30 6403211800 $16.30 6403211900 $16.30 6403212000 $16.30 6403212100 $16.30 Page 53 of 189 City of Chula Vista Engineer's ReportPage 268 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403212200 $16.30 6403212300 $16.30 6403212400 $16.30 6403220100 $16.30 6403220200 $16.30 6403220300 $16.30 6403220400 $16.30 6403220500 $16.30 6403220600 $16.30 6403220700 $16.30 6403220800 $16.30 6403220900 $16.30 6403221000 $16.30 6403221100 $16.30 6403221200 $16.30 6403221300 $16.30 6403221400 $16.30 6403221500 $16.30 6403221600 $16.30 6403221700 $16.30 6403221800 $16.30 6403221900 $16.30 6403222000 $16.30 6403222100 $16.30 6403222200 $16.30 6403222300 $16.30 6403222400 $16.30 6403222500 $16.30 6403222600 $16.30 6403222700 $16.30 6403222800 $16.30 6403222900 $16.30 6403223000 $16.30 6403223100 $16.30 6403223200 $16.30 6403223300 $16.30 6403223400 $16.30 6403223500 $16.30 6403223600 $16.30 6403223700 $16.30 6403223800 $16.30 6403223900 $16.30 6403224000 $16.30 6403224100 $16.30 6403224200 $16.30 6403230100 $16.30 6403230200 $16.30 6403230300 $16.30 6403230400 $16.30 6403230500 $16.30 6403230600 $16.30 6403230700 $16.30 6403230800 $16.30 6403230900 $16.30 6403231000 $16.30 6403231100 $16.30 6403231200 $16.30 6403231300 $16.30 6403231400 $16.30 6403231500 $16.30 6403231600 $16.30 6403231700 $16.30 6403231800 $16.30 6403231900 $16.30 6403232000 $16.30 6403232100 $16.30 6403232200 $16.30 6403232300 $16.30 6403232400 $16.30 6403232500 $16.30 6403232600 $16.30 6403232700 $16.30 6403232800 $16.30 6403232900 $16.30 6403233000 $16.30 6403233100 $16.30 6403233200 $16.30 6403233300 $16.30 6403233400 $16.30 6403233500 $16.30 6403233600 $16.30 6403233700 $16.30 6403233800 $16.30 6403233900 $16.30 6403234000 $16.30 6403300101 $5.70 6403300102 $5.70 6403300103 $5.70 6403300104 $5.70 6403300105 $5.70 6403300106 $5.70 6403300107 $5.70 6403300108 $5.70 6403300109 $5.70 6403300110 $5.70 6403300111 $5.70 6403300201 $5.70 6403300202 $5.70 6403300203 $5.70 6403300204 $5.70 6403300205 $5.70 6403300206 $5.70 6403300207 $5.70 6403300301 $5.70 6403300302 $5.70 6403300303 $5.70 6403300304 $5.70 6403300305 $5.70 6403300306 $5.70 6403300307 $5.70 6403300308 $5.70 6403300401 $5.70 6403300402 $5.70 6403300403 $5.70 6403300404 $5.70 6403300405 $5.70 6403300406 $5.70 6403300407 $5.70 6403300408 $5.70 6403300501 $5.70 6403300502 $5.70 6403300503 $5.70 6403300504 $5.70 6403300505 $5.70 6403300506 $5.70 6403300601 $5.70 6403300602 $5.70 6403300603 $5.70 6403300604 $5.70 6403300605 $5.70 6403300606 $5.70 6403300701 $5.70 6403300702 $5.70 6403300703 $5.70 6403300704 $5.70 6403300705 $5.70 6403300706 $5.70 6403300707 $5.70 6403301101 $5.70 6403301102 $5.70 6403301103 $5.70 Page 54 of 189 City of Chula Vista Engineer's ReportPage 269 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403301104 $5.70 6403301105 $5.70 6403301106 $5.70 6403301107 $5.70 6403301201 $5.70 6403301202 $5.70 6403301203 $5.70 6403301204 $5.70 6403301205 $5.70 6403301206 $5.70 6403301207 $5.70 6403301301 $5.70 6403301302 $5.70 6403301303 $5.70 6403301304 $5.70 6403301305 $5.70 6403301306 $5.70 6403301307 $5.70 6403301401 $5.70 6403301402 $5.70 6403301403 $5.70 6403301404 $5.70 6403301405 $5.70 6403301406 $5.70 6403301407 $5.70 6403301408 $5.70 6403301409 $5.70 6403301501 $5.70 6403301502 $5.70 6403301503 $5.70 6403301504 $5.70 6403301505 $5.70 6403301506 $5.70 6403301507 $5.70 6403301601 $5.70 6403301602 $5.70 6403301603 $5.70 6403301604 $5.70 6403301605 $5.70 6403301606 $5.70 6403301607 $5.70 6403301608 $5.70 6403301701 $5.70 6403301702 $5.70 6403301703 $5.70 6403301704 $5.70 6403301705 $5.70 6403301706 $5.70 6403301707 $5.70 6403301801 $5.70 6403301802 $5.70 6403301803 $5.70 6403301804 $5.70 6403301805 $5.70 6403301806 $5.70 6403301807 $5.70 6403301808 $5.70 6403301901 $5.70 6403301902 $5.70 6403301903 $5.70 6403301904 $5.70 6403301905 $5.70 6403301906 $5.70 6403301907 $5.70 6403301908 $5.70 6403302001 $5.70 6403302002 $5.70 6403302003 $5.70 6403302004 $5.70 6403302005 $5.70 6403302101 $5.70 6403302102 $5.70 6403302103 $5.70 6403302104 $5.70 6403302105 $5.70 6403302106 $5.70 6403302107 $5.70 6403302108 $5.70 6403302201 $5.70 6403302202 $5.70 6403302203 $5.70 6403302204 $5.70 6403302205 $5.70 6403302206 $5.70 6403302207 $5.70 6403302301 $5.70 6403302302 $5.70 6403302303 $5.70 6403302304 $5.70 6403302305 $5.70 6403302306 $5.70 6403302401 $5.70 6403302402 $5.70 6403302403 $5.70 6403302404 $5.70 6403302405 $5.70 6403302406 $5.70 6403302407 $5.70 6403302501 $5.70 6403302502 $5.70 6403302503 $5.70 6403302504 $5.70 6403302505 $5.70 6403302506 $5.70 6403302507 $5.70 6403302508 $5.70 6403302601 $5.70 6403302602 $5.70 6403302603 $5.70 6403302604 $5.70 6403302605 $5.70 6403302606 $5.70 6403302607 $5.70 6403302608 $5.70 6403302701 $5.70 6403302702 $5.70 6403302703 $5.70 6403302704 $5.70 6403302705 $5.70 6403302706 $5.70 6403302707 $5.70 6403304201 $5.70 6403304202 $5.70 6403304203 $5.70 6403304204 $5.70 6403304205 $5.70 6403304206 $5.70 6403304207 $5.70 6403304301 $5.70 6403304302 $5.70 6403304303 $5.70 6403304304 $5.70 6403304305 $5.70 6403304306 $5.70 6403304307 $5.70 6403304308 $5.70 6403304309 $5.70 6403304401 $5.70 6403304402 $5.70 6403304403 $5.70 6403304404 $5.70 Page 55 of 189 City of Chula Vista Engineer's ReportPage 270 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403304405 $5.70 6403304406 $5.70 6403304407 $5.70 6403400100 $11.42 6403400200 $11.42 6403400300 $11.42 6403400400 $11.42 6403400500 $11.42 6403400600 $11.42 6403400700 $11.42 6403400800 $11.42 6403400900 $11.42 6403401000 $11.42 6403401100 $11.42 6403401200 $11.42 6403401300 $11.42 6403401400 $11.42 6403401500 $11.42 6403401600 $11.42 6403401700 $11.42 6403401800 $11.42 6403401900 $11.42 6403405300 $11.42 6403405400 $11.42 6403405500 $11.42 6403405600 $11.42 6403405700 $11.42 6403405800 $11.42 6403405900 $11.42 6403406000 $11.42 6403406100 $11.42 6403406200 $11.42 6403406300 $11.42 6403406400 $11.42 6403500100 $11.42 6403500200 $11.42 6403500300 $11.42 6403500400 $11.42 6403500500 $11.42 6403500600 $11.42 6403500700 $11.42 6403500800 $11.42 6403500900 $11.42 6403501000 $11.42 6403501100 $11.42 6403501200 $11.42 6403501300 $11.42 6403501400 $11.42 6403501500 $11.42 6403501600 $11.42 6403501700 $11.42 6403501800 $11.42 6403501900 $11.42 6403502000 $11.42 6403502100 $11.42 6403502200 $11.42 6403502300 $11.42 6403502400 $11.42 6403502500 $11.42 6403502600 $11.42 6403502700 $11.42 6403502800 $11.42 6403502900 $11.42 6403503000 $11.42 6403503100 $11.42 6403503200 $11.42 6403503300 $11.42 6403503400 $11.42 6403503500 $11.42 6403503600 $11.42 6403503700 $11.42 6403503800 $11.42 6403503900 $11.42 6403504000 $11.42 6403504100 $11.42 6403504200 $11.42 6403504300 $11.42 6403504400 $11.42 6403504500 $11.42 6403504600 $11.42 6403504700 $11.42 6403504800 $11.42 6403504900 $11.42 6403505000 $11.42 6403505100 $11.42 6403505200 $11.42 6403505300 $11.42 6403505400 $11.42 6403505500 $11.42 6403505600 $11.42 6403505700 $11.42 6403505800 $11.42 6403505900 $11.42 6403506000 $11.42 6403506100 $11.42 6403506200 $11.42 6403506300 $11.42 6403506400 $11.42 6403506500 $11.42 6403506600 $11.42 6403506700 $11.42 6403506800 $11.42 6403506900 $11.42 6403507000 $11.42 6403507100 $11.42 6403507200 $11.42 6403510100 $11.42 6403510200 $11.42 6403510300 $11.42 6403510400 $11.42 6403510500 $11.42 6403510600 $11.42 6403510700 $11.42 6403510800 $11.42 6403510900 $11.42 6403511000 $11.42 6403511100 $11.42 6403511200 $11.42 6403511300 $11.42 6403511400 $11.42 6403511500 $11.42 6403511600 $11.42 6403511700 $11.42 6403511800 $11.42 6403511900 $11.42 6403512000 $11.42 6403512100 $11.42 6403512200 $11.42 6403512300 $11.42 6403512400 $11.42 6403512500 $11.42 6403512600 $11.42 6403512700 $11.42 6403512800 $11.42 6403512900 $11.42 6403513000 $11.42 6403513100 $11.42 6403513200 $11.42 6403516700 $11.42 6403516800 $11.42 6403516900 $11.42 Page 56 of 189 City of Chula Vista Engineer's ReportPage 271 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403517000 $11.42 6403517100 $11.42 6403517200 $11.42 6403517300 $11.42 6403517400 $11.42 6403517500 $11.42 6403517600 $11.42 6403517700 $11.42 6403517800 $11.42 6403517900 $11.42 6403518000 $11.42 6403518100 $11.42 6403518200 $11.42 6403518300 $11.42 6403518400 $11.42 6403800100 $16.30 6403800200 $16.30 6403800300 $16.30 6403800400 $16.30 6403800500 $16.30 6403800600 $16.30 6403800700 $16.30 6403800800 $16.30 6403800900 $16.30 6403801000 $16.30 6403801100 $16.30 6403801200 $16.30 6403801300 $16.30 6403801400 $16.30 6403801500 $16.30 6403801600 $16.30 6403801700 $16.30 6403801800 $16.30 6403801900 $16.30 6403802000 $16.30 6403802100 $16.30 6403802200 $16.30 6403802300 $16.30 6403802400 $16.30 6403802500 $16.30 6403802600 $16.30 6403802700 $16.30 6403802800 $16.30 6403802900 $16.30 6403803000 $16.30 6403803100 $16.30 6403803200 $16.30 6403803300 $16.30 6403803400 $16.30 6403803500 $16.30 6403803600 $16.30 6403803700 $16.30 6403803800 $16.30 6403803900 $16.30 6403804000 $16.30 6403804100 $16.30 6403804200 $16.30 6403804300 $16.30 6403804400 $16.30 6403804500 $16.30 6403804600 $16.30 6403804700 $16.30 6403804800 $16.30 6403804900 $16.30 6403805000 $16.30 6403805100 $16.30 6403805200 $16.30 6403805300 $16.30 6403805400 $16.30 6403805500 $16.30 6403805600 $16.30 6403805700 $16.30 6403810100 $16.30 6403810200 $16.30 6403810300 $16.30 6403810400 $16.30 6403810500 $16.30 6403810600 $16.30 6403810700 $16.30 6403810800 $16.30 6403810900 $16.30 6403811000 $16.30 6403811100 $16.30 6403811200 $16.30 6403811300 $16.30 6403811400 $16.30 6403811500 $16.30 6403811600 $16.30 6403811700 $16.30 6403811800 $16.30 6403811900 $16.30 6403812000 $16.30 6403812100 $16.30 6403812200 $16.30 6403812300 $16.30 6403812400 $16.30 6403812500 $16.30 6403812600 $16.30 6403812700 $16.30 6403812800 $16.30 6403812900 $16.30 6403813000 $16.30 6403813100 $16.30 6403813200 $16.30 6403813300 $16.30 6403813400 $16.30 6403814300 $16.30 6403814400 $16.30 6403814500 $16.30 6403814600 $16.30 6403814700 $16.30 6403815100 $16.30 6403815200 $16.30 6403815300 $16.30 6403815400 $16.30 6403815500 $16.30 6403815600 $16.30 6403815700 $16.30 6403815800 $16.30 6403815900 $16.30 6403816000 $16.30 6403816100 $16.30 6403816200 $16.30 6403816300 $16.30 6403816400 $16.30 6403816500 $16.30 6403816600 $16.30 6403816700 $16.30 6403816800 $16.30 6403816900 $16.30 6403817000 $16.30 6403817100 $16.30 6403817200 $16.30 6403817300 $16.30 6403817400 $16.30 6403817500 $16.30 6403817600 $16.30 6403817700 $16.30 6403817800 $16.30 6403817900 $16.30 6403818000 $16.30 Page 57 of 189 City of Chula Vista Engineer's ReportPage 272 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403818100 $16.30 6403818200 $16.30 6403818300 $16.30 6403818400 $16.30 6403818500 $16.30 6403900100 $16.30 6403900200 $16.30 6403900300 $16.30 6403900400 $16.30 6403900500 $16.30 6403900600 $16.30 6403900700 $16.30 6403900800 $16.30 6403900900 $16.30 6403901000 $16.30 6403901100 $16.30 6403901200 $16.30 6403901300 $16.30 6403901400 $16.30 6403901500 $16.30 6403901600 $16.30 6403901700 $16.30 6403901800 $16.30 6403901900 $16.30 6403902000 $16.30 6403910100 $16.30 6403910200 $16.30 6403910300 $16.30 6403910400 $16.30 6403910500 $16.30 6403910600 $16.30 6403910700 $16.30 6403910800 $16.30 6403910900 $16.30 6403911000 $16.30 6403911100 $16.30 6403911200 $16.30 6403911300 $16.30 6403911400 $16.30 6403911500 $16.30 6403911600 $16.30 6403911700 $16.30 6403911800 $16.30 6403911900 $16.30 6403912000 $16.30 6403912100 $16.30 6403912200 $16.30 6403912300 $16.30 6403912400 $16.30 6403912500 $16.30 6403912600 $16.30 6403912700 $16.30 6403912800 $16.30 6403912900 $16.30 6403913000 $16.30 6403913100 $16.30 6403913200 $16.30 6403913300 $16.30 6403913400 $16.30 6403913500 $16.30 6403913600 $16.30 6403913700 $16.30 6403913800 $16.30 6403913900 $16.30 6403914000 $16.30 6403914100 $16.30 6403914200 $16.30 6403920100 $16.30 6403920200 $16.30 6403920300 $16.30 6403920400 $16.30 6403920500 $16.30 6403920600 $16.30 6403920700 $16.30 6403920800 $16.30 6403920900 $16.30 6403921000 $16.30 6403921100 $16.30 6403921200 $16.30 6403921300 $16.30 6403921400 $16.30 6403921500 $16.30 6403921600 $16.30 6403921700 $16.30 6403921800 $16.30 6403921900 $16.30 6403922000 $16.30 6403922100 $16.30 6403922200 $16.30 6403922300 $16.30 6403922400 $16.30 6403922500 $16.30 6403922600 $16.30 6403922700 $16.30 6403922800 $16.30 6403922900 $16.30 6403923000 $16.30 6403923100 $16.30 6403923200 $16.30 6403923300 $16.30 6403923400 $16.30 6403923500 $16.30 6403923600 $16.30 6403923700 $16.30 6403923800 $16.30 6403923900 $16.30 6403924000 $16.30 6403924100 $16.30 6403924200 $16.30 6403924300 $16.30 6403924400 $16.30 6403924500 $16.30 6403924600 $16.30 6403924700 $16.30 6403924800 $16.30 6403924900 $16.30 6403925000 $16.30 6403925100 $16.30 6403925200 $16.30 6403925300 $16.30 6403925400 $16.30 6403925500 $16.30 6403926900 $16.30 6403927000 $16.30 6403927100 $16.30 6403927200 $16.30 6403927300 $16.30 6403927400 $16.30 6403927500 $16.30 6403927600 $16.30 6403927700 $16.30 6403927800 $16.30 6403927900 $16.30 6403928000 $16.30 6404000100 $8.14 6404000200 $8.14 6404000300 $8.14 6404000400 $8.14 6404000500 $8.14 6404000600 $8.14 6404000700 $8.14 Page 58 of 189 City of Chula Vista Engineer's ReportPage 273 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404000800 $8.14 6404000900 $8.14 6404001000 $8.14 6404001100 $8.14 6404001200 $8.14 6404001300 $8.14 6404001400 $8.14 6404001500 $8.14 6404001600 $8.14 6404001700 $8.14 6404001800 $8.14 6404001900 $8.14 6404002000 $8.14 6404002100 $8.14 6404002200 $8.14 6404002300 $8.14 6404002400 $8.14 6404002500 $8.14 6404002600 $8.14 6404002700 $8.14 6404002800 $8.14 6404002900 $8.14 6404003000 $8.14 6404003100 $8.14 6404003200 $8.14 6404003300 $8.14 6404003400 $8.14 6404003500 $8.14 6404003600 $8.14 6404003700 $8.14 6404003800 $8.14 6404003900 $8.14 6404004000 $8.14 6404004100 $8.14 6404004200 $8.14 6404004300 $8.14 6404004400 $8.14 6404004500 $8.14 6404004600 $8.14 6404004700 $8.14 6404004800 $8.14 6404004900 $8.14 6404005000 $8.14 6404005100 $8.14 6404005200 $8.14 6404005300 $8.14 6404005400 $8.14 6404005500 $8.14 6404005600 $8.14 6404005700 $8.14 6404005800 $8.14 6404005900 $8.14 6404006000 $8.14 6404006100 $8.14 6404006200 $8.14 6404006300 $8.14 6404006400 $8.14 6404006500 $8.14 6404006600 $8.14 6404006700 $8.14 6404006800 $8.14 6404010100 $8.14 6404010200 $8.14 6404010300 $8.14 6404010400 $8.14 6404010500 $8.14 6404010600 $8.14 6404010700 $8.14 6404010800 $8.14 6404010900 $8.14 6404011000 $8.14 6404011100 $8.14 6404011200 $8.14 6404011300 $8.14 6404011400 $8.14 6404011500 $8.14 6404011600 $8.14 6404011700 $8.14 6404011800 $8.14 6404011900 $8.14 6404012000 $8.14 6404012100 $8.14 6404012200 $8.14 6404012300 $8.14 6404012400 $8.14 6404012500 $8.14 6404012600 $8.14 6404012700 $8.14 6404012800 $8.14 6404012900 $8.14 6404013000 $8.14 6404013100 $8.14 6404013200 $8.14 6404013300 $8.14 6404013400 $8.14 6404013500 $8.14 6404013600 $8.14 6404013700 $8.14 6404013800 $8.14 6404013900 $8.14 6404014000 $8.14 6404014100 $8.14 6404014200 $8.14 6404014300 $8.14 6404014400 $8.14 6404014500 $8.14 6404014600 $8.14 6404014700 $8.14 6404014800 $8.14 6404014900 $8.14 6404015000 $8.14 6404015100 $8.14 6404015200 $8.14 6404100100 $81.58 6404100200 $81.58 6404100300 $81.58 6404100400 $81.58 6404100500 $81.58 6404100600 $81.58 6404100700 $81.58 6404100800 $81.58 6404100900 $81.58 6404101000 $81.58 6404101100 $81.58 6404101200 $81.58 6404101300 $81.58 6404101400 $81.58 6404101500 $81.58 6404101600 $81.58 6404101700 $81.58 6404101800 $81.58 6404101900 $81.58 6404102000 $81.58 6404102100 $81.58 6404102200 $81.58 6404102300 $81.58 6404102400 $81.58 6404102500 $81.58 6404102600 $81.58 6404102700 $81.58 6404102800 $81.58 Page 59 of 189 City of Chula Vista Engineer's ReportPage 274 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404102900 $81.58 6404103000 $81.58 6404103100 $81.58 6404103200 $81.58 6404103300 $81.58 6404103400 $81.58 6404103500 $81.58 6404103600 $81.58 6404103700 $81.58 6404103800 $81.58 6404103900 $81.58 6404104000 $81.58 6404104100 $81.58 6404104200 $81.58 6404104300 $81.58 6404104400 $81.58 6404104500 $81.58 6404104600 $81.58 6404104700 $81.58 6404104800 $81.58 6404104900 $81.58 6404105000 $81.58 6404105100 $81.58 6404110100 $81.58 6404110200 $81.58 6404110300 $81.58 6404110400 $81.58 6404110500 $81.58 6404110600 $81.58 6404110700 $81.58 6404110800 $81.58 6404110900 $81.58 6404111000 $81.58 6404111100 $81.58 6404111200 $81.58 6404111300 $81.58 6404111400 $81.58 6404111500 $81.58 6404111600 $81.58 6404111700 $81.58 6404111800 $81.58 6404111900 $81.58 6404112000 $81.58 6404112100 $81.58 6404112200 $81.58 6404112300 $81.58 6404112400 $81.58 6404112500 $81.58 6404112600 $81.58 6404112700 $81.58 6404112800 $81.58 6404112900 $81.58 6404113000 $81.58 6404113100 $81.58 6404113200 $81.58 6404113300 $81.58 6404113400 $81.58 6404113500 $81.58 6404113600 $81.58 6404113700 $81.58 6404113800 $81.58 6404113900 $81.58 6404114000 $81.58 6404114100 $81.58 6404114200 $81.58 6404114300 $81.58 6404114400 $81.58 6404114500 $81.58 6404114600 $81.58 6404114700 $81.58 6404114800 $81.58 6404114900 $81.58 6404115000 $81.58 6404115100 $81.58 6404115200 $81.58 6404115300 $81.58 6404115400 $81.58 6404115500 $81.58 6404115600 $81.58 6404115700 $81.58 6404115800 $81.58 6404115900 $81.58 6404116000 $81.58 6404116100 $81.58 6404116200 $81.58 6404116300 $81.58 6404116400 $81.58 6404116500 $81.58 6404116600 $81.58 6404116700 $81.58 6404116800 $81.58 6404116900 $81.58 6404117000 $81.58 6404117100 $81.58 6404117200 $81.58 6404117300 $81.58 6404117400 $81.58 6404117500 $81.58 6404117600 $81.58 6404117700 $81.58 6404117800 $81.58 6404117900 $81.58 6404118000 $81.58 6404118100 $81.58 6404200100 $26.92 6404200200 $26.92 6404200300 $26.92 6404200400 $26.92 6404200500 $26.92 6404200600 $26.92 6404200700 $26.92 6404200800 $26.92 6404200900 $26.92 6404201000 $26.92 6404201100 $26.92 6404201200 $26.92 6404201300 $26.92 6404201400 $26.92 6404201500 $26.92 6404201600 $26.92 6404201700 $26.92 6404201800 $26.92 6404201900 $26.92 6404202000 $26.92 6404202100 $26.92 6404202200 $26.92 6404202300 $26.92 6404202400 $26.92 6404202500 $26.92 6404202600 $26.92 6404202700 $26.92 6404202800 $26.92 6404202900 $26.92 6404203000 $26.92 6404203100 $26.92 6404203200 $26.92 6404203300 $26.92 6404203400 $26.92 6404203500 $26.92 6404203600 $26.92 6404203700 $26.92 Page 60 of 189 City of Chula Vista Engineer's ReportPage 275 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404203800 $26.92 6404203900 $26.92 6404204000 $26.92 6404204100 $26.92 6404204200 $26.92 6404204300 $26.92 6404204400 $26.92 6404204500 $26.92 6404204600 $26.92 6404204700 $26.92 6404204800 $26.92 6404204900 $26.92 6404205000 $26.92 6404205100 $26.92 6404205200 $26.92 6404205300 $26.92 6404205400 $26.92 6404205500 $26.92 6404205600 $26.92 6404205700 $26.92 6404205800 $26.92 6404205900 $26.92 6404206000 $26.92 6404206100 $26.92 6404206200 $26.92 6404206300 $26.92 6404210100 $26.92 6404210200 $26.92 6404210300 $26.92 6404210400 $26.92 6404210500 $26.92 6404210600 $26.92 6404210700 $26.92 6404210800 $26.92 6404210900 $26.92 6404211000 $26.92 6404211100 $26.92 6404211200 $26.92 6404211300 $26.92 6404211400 $26.92 6404211500 $26.92 6404211600 $26.92 6404211700 $26.92 6404211800 $26.92 6404211900 $26.92 6404212000 $26.92 6404212100 $26.92 6404212200 $26.92 6404212300 $26.92 6404212400 $26.92 6404212500 $26.92 6404212600 $26.92 6404212700 $26.92 6404212800 $26.92 6404212900 $26.92 6404213000 $26.92 6404213100 $26.92 6404213200 $26.92 6404213300 $26.92 6404213400 $26.92 6404213500 $26.92 6404213600 $26.92 6404213700 $26.92 6404213800 $26.92 6404213900 $26.92 6404214000 $26.92 6404214100 $26.92 6404214200 $26.92 6404214300 $26.92 6404214400 $26.92 6404214500 $26.92 6404214600 $26.92 6404214700 $26.92 6404214800 $26.92 6404214900 $26.92 6404215000 $26.92 6404215100 $26.92 6404215200 $26.92 6404215300 $26.92 6404215400 $26.92 6404215500 $26.92 6404215600 $26.92 6404215700 $26.92 6404215800 $26.92 6404215900 $26.92 6404216000 $26.92 6404216100 $26.92 6404216200 $26.92 6404216300 $26.92 6404216400 $26.92 6404216500 $26.92 6404216600 $26.92 6404216700 $26.92 6404216800 $26.92 6404216900 $26.92 6404217000 $26.92 6404217100 $26.92 6404217200 $26.92 6404217300 $26.92 6404217400 $26.92 6404217500 $26.92 6404217600 $26.92 6404217700 $26.92 6404217800 $26.92 6404217900 $26.92 6404218000 $26.92 6404218100 $26.92 6404218200 $26.92 6404218300 $26.92 6404218400 $26.92 6404218500 $26.92 6404218600 $26.92 6404218700 $26.92 6404218800 $26.92 6420110300 $16.30 6420110400 $16.30 6420110500 $16.30 6420110600 $16.30 6420110700 $16.30 6420110800 $16.30 6420110900 $16.30 6420111000 $16.30 6420111100 $16.30 6420111200 $16.30 6420111300 $16.30 6420111400 $16.30 6420111500 $16.30 6420111600 $16.30 6420111700 $16.30 6420111800 $16.30 6420111900 $16.30 6420112000 $16.30 6420112100 $16.30 6420112200 $16.30 6420112300 $16.30 6420112400 $16.30 6420112500 $16.30 6423800401 $8.14 6423800402 $8.14 6423800403 $8.14 6423800404 $8.14 Page 61 of 189 City of Chula Vista Engineer's ReportPage 276 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423800405 $8.14 6423800406 $8.14 6423800407 $8.14 6423800408 $8.14 6423800409 $8.14 6423800410 $8.14 6423800411 $8.14 6423800412 $8.14 6423800413 $8.14 6423800414 $8.14 6423800415 $8.14 6423800416 $8.14 6423800417 $8.14 6423800418 $8.14 6423800419 $8.14 6423800420 $8.14 6423800421 $8.14 6423800422 $8.14 6423800423 $8.14 6423800424 $8.14 6423800425 $8.14 6423800426 $8.14 6423800427 $8.14 6423800501 $8.14 6423800502 $8.14 6423800503 $8.14 6423800504 $8.14 6423800505 $8.14 6423800506 $8.14 6423800507 $8.14 6423800508 $8.14 6423800509 $8.14 6423800510 $8.14 6423800511 $8.14 6423800512 $8.14 6423800513 $8.14 6423800514 $8.14 6423800515 $8.14 6423800516 $8.14 6423800517 $8.14 6423800518 $8.14 6423800519 $8.14 6423800520 $8.14 6423800521 $8.14 6423800601 $8.14 6423800602 $8.14 6423800603 $8.14 6423800604 $8.14 6423800605 $8.14 6423800606 $8.14 6423800607 $8.14 6423800608 $8.14 6423800609 $8.14 6423800610 $8.14 6423800611 $8.14 6423800612 $8.14 6423800613 $8.14 6423800614 $8.14 6423800615 $8.14 6423800616 $8.14 6423800617 $8.14 6423800618 $8.14 6423800619 $8.14 6423800701 $8.14 6423800702 $8.14 6423800703 $8.14 6423800704 $8.14 6423800705 $8.14 6423800706 $8.14 6423800707 $8.14 6423800708 $8.14 6423800709 $8.14 6423800710 $8.14 6423800711 $8.14 6423800712 $8.14 6423800713 $8.14 6423800714 $8.14 6423800715 $8.14 6423800716 $8.14 6423800717 $8.14 6423800718 $8.14 6423800719 $8.14 6423800720 $8.14 6423800721 $8.14 6423800722 $8.14 6423801001 $8.14 6423801002 $8.14 6423801003 $8.14 6423801101 $8.14 6423801102 $8.14 6423801103 $8.14 6423801104 $8.14 6423801105 $8.14 6423801501 $8.14 6423801502 $8.14 6423801503 $8.14 6423801504 $8.14 6423801505 $8.14 6423801506 $8.14 6423801507 $8.14 6423801508 $8.14 6423801509 $8.14 6423801510 $8.14 6423801511 $8.14 6423801512 $8.14 6423801513 $8.14 6423801514 $8.14 6423801515 $8.14 6423801516 $8.14 6423801517 $8.14 6423801601 $8.14 6423801602 $8.14 6423801603 $8.14 6423801604 $8.14 6423801605 $8.14 6423801606 $8.14 6423801607 $8.14 6423801608 $8.14 6423801609 $8.14 6423801610 $8.14 6423801611 $8.14 6423801612 $8.14 6423801613 $8.14 6423801614 $8.14 6423801615 $8.14 6423801701 $8.14 6423801702 $8.14 6423801703 $8.14 6423801704 $8.14 6423801705 $8.14 6423801706 $8.14 6423801707 $8.14 6423801708 $8.14 6423801709 $8.14 6423801710 $8.14 6423801711 $8.14 6423801712 $8.14 6423801713 $8.14 6423801714 $8.14 6423801715 $8.14 6423801716 $8.14 Page 62 of 189 City of Chula Vista Engineer's ReportPage 277 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423801717 $8.14 6423801718 $8.14 6423920100 $775.08 6423920200 $603.74 6423920300 $481.36 6423921200 $1,174.88 6423921300 $1,044.32 6424100101 $8.14 6424100102 $8.14 6424100103 $8.14 6424100104 $8.14 6424100105 $8.14 6424100106 $8.14 6424100107 $8.14 6424100108 $8.14 6424100109 $8.14 6424100110 $8.14 6424100111 $8.14 6424100112 $8.14 6424100113 $8.14 6424100114 $8.14 6424100115 $8.14 6424100116 $8.14 6424100117 $8.14 6424100118 $8.14 6424100119 $8.14 6424100120 $8.14 6424100121 $8.14 6424100122 $8.14 6424100123 $8.14 6424100124 $8.14 6424100301 $8.14 6424100302 $8.14 6424100303 $8.14 6424100304 $8.14 6424100305 $8.14 6424100306 $8.14 6424100307 $8.14 6424100308 $8.14 6424100309 $8.14 6424100310 $8.14 6424100311 $8.14 6424100312 $8.14 6424100313 $8.14 6424100314 $8.14 6424100315 $8.14 6424100316 $8.14 6424100317 $8.14 6424100318 $8.14 6424100319 $8.14 6424100320 $8.14 6424100321 $8.14 6424100322 $8.14 6424100323 $8.14 6424100324 $8.14 6424100325 $8.14 6424100701 $8.14 6424100702 $8.14 6424100703 $8.14 6424100704 $8.14 6424100705 $8.14 6424100706 $8.14 6424100707 $8.14 6424100708 $8.14 6424100709 $8.14 6424100710 $8.14 6424100711 $8.14 6424100712 $8.14 6424100713 $8.14 6424100801 $8.14 6424100802 $8.14 6424100803 $8.14 6424100804 $8.14 6424100805 $8.14 6424100806 $8.14 6424100807 $8.14 6424100808 $8.14 6424100809 $8.14 6424100810 $8.14 6424100811 $8.14 6424100812 $8.14 6424100813 $8.14 6424100814 $8.14 6424100815 $8.14 6424100816 $8.14 6424100817 $8.14 6424100818 $8.14 6424100819 $8.14 6424101301 $8.14 6424101302 $8.14 6424101303 $8.14 6424101304 $8.14 6424101305 $8.14 6424101306 $8.14 6424101307 $8.14 6424101308 $8.14 6424101401 $8.14 6424101402 $8.14 6424101403 $8.14 6424101404 $8.14 6424101405 $8.14 6424101406 $8.14 6424101407 $8.14 6424101408 $8.14 6424101409 $8.14 6424101410 $8.14 6424101411 $8.14 6424101412 $8.14 6424101413 $8.14 6424101414 $8.14 6424101415 $8.14 6424101416 $8.14 6424101501 $8.14 6424101502 $8.14 6424101503 $8.14 6424101504 $8.14 6424101505 $8.14 6424101506 $8.14 6424101507 $8.14 6424101508 $8.14 6424101509 $8.14 6424101510 $8.14 6424101511 $8.14 6424101512 $8.14 6424101513 $8.14 6424101514 $8.14 6424101515 $8.14 6424101516 $8.14 6424101517 $8.14 6424101518 $8.14 6424101601 $8.14 6424101602 $8.14 6424101603 $8.14 6424101604 $8.14 6424101605 $8.14 6424101606 $8.14 6424101607 $8.14 6424101608 $8.14 6424101609 $8.14 6424101610 $8.14 6424101611 $8.14 Page 63 of 189 City of Chula Vista Engineer's ReportPage 278 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-75 - OSD 20 Zone 1 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6424101612 $8.14 6424101613 $8.14 6424101614 $8.14 6424101615 $8.14 Totals Parcels 2,824 Levy $71,924.28 Page 64 of 189 City of Chula Vista Engineer's ReportPage 279 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5931410100 $6.18 5931410200 $6.18 5931410300 $6.18 5931410400 $6.18 5931410500 $6.18 5931410600 $6.18 5931410700 $6.18 5931410800 $6.18 5931410900 $6.18 5931411000 $6.18 5931411100 $6.18 5931411200 $6.18 5931411300 $6.18 5931411400 $6.18 5931411500 $6.18 5931411600 $6.18 5931411700 $6.18 5931411800 $6.18 5931411900 $6.18 5931412000 $6.18 5931412100 $6.18 5931420100 $6.18 5931420200 $6.18 5931420300 $6.18 5931420400 $6.18 5931420500 $6.18 5931420600 $6.18 5931420700 $6.18 5931420800 $6.18 5931420900 $6.18 5931421000 $6.18 5931421100 $6.18 5931421200 $6.18 5931421300 $6.18 5931421400 $6.18 5931421500 $6.18 5931421600 $6.18 5931421700 $6.18 5931421800 $6.18 5931421900 $6.18 5931422000 $6.18 5931422100 $6.18 5931422200 $6.18 5931422300 $6.18 5931422400 $6.18 5931422500 $6.18 5931422600 $6.18 5931422700 $6.18 5931422800 $6.18 5931422900 $6.18 5931423000 $6.18 5931423100 $6.18 5931423200 $6.18 5931423300 $6.18 5931423400 $6.18 5931423500 $6.18 5931430100 $6.18 5931430300 $6.18 5931430400 $6.18 5931430500 $6.18 5931430600 $6.18 5931430700 $6.18 5931430800 $6.18 5931430900 $6.18 5931431000 $6.18 5931431100 $6.18 5931431200 $6.18 5931431300 $6.18 5931431400 $6.18 5931431500 $6.18 5931431600 $6.18 5931431700 $6.18 5931431800 $6.18 5931431900 $6.18 5931432000 $6.18 5931432100 $6.18 5931432200 $6.18 5931432600 $6.18 5933600100 $6.18 5933600200 $6.18 5933600300 $6.18 5933600400 $6.18 5933600500 $6.18 5933600600 $6.18 5933600700 $6.18 5933600800 $6.18 5933600900 $6.18 5933601000 $6.18 5933601100 $6.18 5933601200 $6.18 5933601300 $6.18 5933601400 $6.18 5933601500 $6.18 5933601600 $6.18 5933601700 $6.18 5933601800 $6.18 5933601900 $6.18 5933602000 $6.18 5933602100 $6.18 5933602200 $6.18 5933602300 $6.18 5933602400 $6.18 5933602500 $6.18 5933602600 $6.18 5933602700 $6.18 5933602800 $6.18 5933602900 $6.18 5933603000 $6.18 5933603100 $6.18 5933610100 $6.18 5933610200 $6.18 5933610300 $6.18 5933610400 $6.18 5933610500 $6.18 5933610600 $6.18 5933610700 $6.18 5933610800 $6.18 5933610900 $6.18 5933611000 $6.18 5933611100 $6.18 5933611200 $6.18 5933611300 $6.18 5933611400 $6.18 5933611500 $6.18 5933611600 $6.18 5933611700 $6.18 5933611800 $6.18 5933611900 $6.18 5933612000 $6.18 5933612100 $6.18 5933612200 $6.18 5933612300 $6.18 5933612400 $6.18 5933612500 $6.18 5933612600 $6.18 5933612700 $6.18 5933612800 $6.18 5933612900 $6.18 5933620100 $6.18 5933620200 $6.18 5933620300 $6.18 Assessment Roll Page 65 of 189 City of Chula Vista Engineer's ReportPage 280 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933620400 $6.18 5933620500 $6.18 5933620600 $6.18 5933620700 $6.18 5933620800 $6.18 5933620900 $6.18 5933621000 $6.18 5933621100 $6.18 5933621200 $6.18 5933621300 $6.18 5933621400 $6.18 5933621500 $6.18 5933621600 $6.18 5933621700 $6.18 5933622200 $6.18 5933622300 $6.18 5933700100 $6.18 5933700200 $6.18 5933700300 $6.18 5933700400 $6.18 5933700500 $6.18 5933700600 $6.18 5933700700 $6.18 5933700800 $6.18 5933700900 $6.18 5933701000 $6.18 5933701100 $6.18 5933701200 $6.18 5933701300 $6.18 5933701400 $6.18 5933701500 $6.18 5933701600 $6.18 5933701700 $6.18 5933701800 $6.18 5933701900 $6.18 5933702000 $6.18 5933702100 $6.18 5933702200 $6.18 5933702300 $6.18 5933702400 $6.18 5933702500 $6.18 5933702600 $6.18 5933702700 $6.18 5933702800 $6.18 5933702900 $6.18 5933703000 $6.18 5933703100 $6.18 5933703200 $6.18 5933703300 $6.18 5933703400 $6.18 5933703500 $6.18 5933703600 $6.18 5933703700 $6.18 5933703800 $6.18 5933703900 $6.18 5933704000 $6.18 5933704100 $6.18 5933704200 $6.18 5933704300 $6.18 5933704400 $6.18 5933704500 $6.18 5933704600 $6.18 5933704700 $6.18 5933704800 $6.18 5933710100 $6.18 5933710200 $6.18 5933710300 $6.18 5933710400 $6.18 5933710500 $6.18 5933710600 $6.18 5933710700 $6.18 5933710800 $6.18 5933710900 $6.18 5933711000 $6.18 5933711100 $6.18 5933711200 $6.18 5933711300 $6.18 5933711400 $6.18 5933711500 $6.18 5933711600 $6.18 5933711700 $6.18 5933711800 $6.18 5933711900 $6.18 5933712000 $6.18 5933712100 $6.18 5933712200 $6.18 5933712300 $6.18 5933712400 $6.18 5933712500 $6.18 5933712600 $6.18 5933712700 $6.18 5933712800 $6.18 5933712900 $6.18 5933713000 $6.18 5933713100 $6.18 5933713200 $6.18 5933713300 $6.18 5933713400 $6.18 5933713500 $6.18 5933713600 $6.18 5933713700 $6.18 5933713800 $6.18 5933713900 $6.18 5933714000 $6.18 5933714100 $6.18 5933714200 $6.18 5933714300 $6.18 5933714400 $6.18 5933714500 $6.18 5933714600 $6.18 5933714700 $6.18 5933714800 $6.18 5933714900 $6.18 5933715000 $6.18 5933715100 $6.18 5933715200 $6.18 5933715300 $6.18 5933715400 $6.18 5933715500 $6.18 5933715600 $6.18 5933715700 $6.18 5933715800 $6.18 5933715900 $6.18 5933716000 $6.18 5933716100 $6.18 5933716200 $6.18 5933716300 $6.18 5933716400 $6.18 5933716500 $6.18 5933716600 $6.18 5933716700 $6.18 5933716800 $6.18 5933716900 $6.18 5933717000 $6.18 5933717100 $6.18 5933717200 $6.18 5933717300 $6.18 5933717500 $6.18 5933717600 $6.18 5933717700 $6.18 5933717800 $6.18 Page 66 of 189 City of Chula Vista Engineer's ReportPage 281 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933717900 $6.18 5933718000 $6.18 5933718100 $6.18 5933718200 $6.18 5933718300 $6.18 5933718400 $6.18 5933718500 $6.18 5933720100 $6.18 5933720200 $6.18 5933720300 $6.18 5933720400 $6.18 5933720500 $6.18 5933720600 $6.18 5933720700 $6.18 5933720800 $6.18 5933720900 $6.18 5933721000 $6.18 5933721100 $6.18 5933721200 $6.18 5933721300 $6.18 5933721400 $6.18 5933721500 $6.18 5933721600 $6.18 5933721700 $6.18 5933721800 $6.18 5933721900 $6.18 5933722000 $6.18 5933722100 $6.18 5933722200 $6.18 5933722300 $6.18 5933722400 $6.18 5933722500 $6.18 5933722600 $6.18 5933722700 $6.18 5933722800 $6.18 5933722900 $6.18 5933723000 $6.18 5933723100 $6.18 5933723200 $6.18 5933723300 $6.18 5933723400 $6.18 5933723500 $6.18 5933723600 $6.18 5933723700 $6.18 5933723800 $6.18 5933723900 $6.18 5933724000 $6.18 5933724100 $6.18 5933724200 $6.18 5933724300 $6.18 5933724400 $6.18 5933724500 $6.18 5933724600 $6.18 5933724700 $6.18 5933724800 $6.18 5933724900 $6.18 5933725000 $6.18 5933725100 $6.18 5933725200 $6.18 5933725300 $6.18 5933725400 $6.18 5933725500 $6.18 5933725600 $6.18 5933730100 $6.18 5933730200 $6.18 5933730300 $6.18 5933730400 $6.18 5933730500 $6.18 5933730600 $6.18 5933730700 $6.18 5933730800 $6.18 5933730900 $6.18 5933731000 $6.18 5933731100 $6.18 5933731200 $6.18 5933731300 $6.18 5933731400 $6.18 5933731500 $6.18 5933731600 $6.18 5933731700 $6.18 5933731800 $6.18 5933731900 $6.18 5933732000 $6.18 5933732100 $6.18 5933732200 $6.18 5933732300 $6.18 5933732400 $6.18 5933732500 $6.18 5933732600 $6.18 5933732700 $6.18 5933732800 $6.18 5933732900 $6.18 5933733000 $6.18 5933733100 $6.18 5933733200 $6.18 5933733300 $6.18 5933733400 $6.18 5933733500 $6.18 5933733600 $6.18 5933733700 $6.18 5933733800 $6.18 5933733900 $6.18 5933734000 $6.18 5933734100 $6.18 5933734200 $6.18 5933734300 $6.18 5933734400 $6.18 5933734500 $6.18 5933734600 $6.18 5933734700 $6.18 5933734800 $6.18 5933734900 $6.18 5933735000 $6.18 5933735100 $6.18 5933735200 $6.18 5933735300 $6.18 5933735400 $6.18 5933735500 $6.18 5933735600 $6.18 5933735700 $6.18 5933735800 $6.18 5933735900 $6.18 5933736000 $6.18 5933736100 $6.18 5933800100 $6.18 5933800200 $6.18 5933800300 $6.18 5933800400 $6.18 5933800500 $6.18 5933800600 $6.18 5933800700 $6.18 5933800800 $6.18 5933800900 $6.18 5933801000 $6.18 5933801100 $6.18 5933801200 $6.18 5933801300 $6.18 5933801400 $6.18 5933801500 $6.18 5933801600 $6.18 5933801700 $6.18 Page 67 of 189 City of Chula Vista Engineer's ReportPage 282 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933801800 $6.18 5933801900 $6.18 5933802000 $6.18 5933802100 $6.18 5933802200 $6.18 5933802300 $6.18 5933802400 $6.18 5933802500 $6.18 5933802600 $6.18 5933802700 $6.18 5933802800 $6.18 5933802900 $6.18 5933803000 $6.18 5933803100 $6.18 5933803200 $6.18 5933803300 $6.18 5933810100 $6.18 5933810200 $6.18 5933810300 $6.18 5933810400 $6.18 5933810500 $6.18 5933810600 $6.18 5933810700 $6.18 5933810800 $6.18 5933810900 $6.18 5933811000 $6.18 5933811100 $6.18 5933811200 $6.18 5933811300 $6.18 5933811400 $6.18 5933811500 $6.18 5933811600 $6.18 5933811700 $6.18 5933811800 $6.18 5933811900 $6.18 5933812000 $6.18 5933812100 $6.18 5933812200 $6.18 5933812300 $6.18 5933812400 $6.18 5933812500 $6.18 5933812600 $6.18 5933812700 $6.18 5933812800 $6.18 5933812900 $6.18 5933813000 $6.18 5933813100 $6.18 5933813200 $6.18 5933813300 $6.18 5933813400 $6.18 5933813500 $6.18 5933813600 $6.18 5933813700 $6.18 5933820100 $6.18 5933820200 $6.18 5933820300 $6.18 5933820400 $6.18 5933820500 $6.18 5933820600 $6.18 5933820700 $6.18 5933820800 $6.18 5933820900 $6.18 5933821000 $6.18 5933821100 $6.18 5933821200 $6.18 5933821300 $6.18 5933821400 $6.18 5933821500 $6.18 5933821600 $6.18 5933821700 $6.18 5933821800 $6.18 5933821900 $6.18 5933822000 $6.18 5933822100 $6.18 5933822200 $6.18 5933822300 $6.18 5933822400 $6.18 5933822500 $6.18 5933822600 $6.18 5933822700 $6.18 5933822800 $6.18 5933822900 $6.18 5933823000 $6.18 5933823100 $6.18 5933823200 $6.18 5933823300 $6.18 5933823400 $6.18 5933823500 $6.18 5933823600 $6.18 5933823700 $6.18 5933900100 $6.18 5933900200 $6.18 5933900300 $6.18 5933900400 $6.18 5933900500 $6.18 5933900600 $6.18 5933900700 $6.18 5933900800 $6.18 5933900900 $6.18 5933901000 $6.18 5933901100 $6.18 5933901200 $6.18 5933901300 $6.18 5933901400 $6.18 5933901500 $6.18 5933901600 $6.18 5933901700 $6.18 5933901800 $6.18 5933901900 $6.18 5933902000 $6.18 5933902100 $6.18 5933902200 $6.18 5933902300 $6.18 5933902400 $6.18 5933902500 $6.18 5933902600 $6.18 5933902700 $6.18 5933910100 $6.18 5933910200 $6.18 5933910300 $6.18 5933910400 $6.18 5933910500 $6.18 5933910600 $6.18 5933910700 $6.18 5933910800 $6.18 5933910900 $6.18 5933911000 $6.18 5933911100 $6.18 5933911200 $6.18 5933911300 $6.18 5933911400 $6.18 5933911500 $6.18 5933911600 $6.18 5933911700 $6.18 5933911800 $6.18 5933911900 $6.18 5933912000 $6.18 5933912100 $6.18 5933912200 $6.18 5933912300 $6.18 5933912400 $6.18 Page 68 of 189 City of Chula Vista Engineer's ReportPage 283 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933912500 $6.18 5933912600 $6.18 5933912700 $6.18 5933912800 $6.18 5933912900 $6.18 5933913000 $6.18 5933920100 $6.18 5933920400 $6.18 5933920500 $6.18 5933920600 $6.18 5933920700 $6.18 5933920800 $6.18 5933920900 $6.18 5933921000 $6.18 5933921100 $6.18 5933921200 $6.18 5933921600 $6.18 5933922000 $6.18 5934000100 $6.18 5934000200 $6.18 5934000300 $6.18 5934000400 $6.18 5934000500 $6.18 5934000600 $6.18 5934000700 $6.18 5934000800 $6.18 5934000900 $6.18 5934001000 $6.18 5934001100 $6.18 5934001200 $6.18 5934001300 $6.18 5934001400 $6.18 5934001500 $6.18 5934001600 $6.18 5934001700 $6.18 5934001800 $6.18 5934001900 $6.18 5934002000 $6.18 5934002100 $6.18 5934002200 $6.18 5934002300 $6.18 5934002400 $6.18 5934002500 $6.18 5934002600 $6.18 5934002700 $6.18 5934010100 $6.18 5934010200 $6.18 5934010300 $6.18 5934010400 $6.18 5934010500 $6.18 5934010600 $6.18 5934010700 $6.18 5934010800 $6.18 5934010900 $6.18 5934011000 $6.18 5934011100 $6.18 5934011200 $6.18 5934011300 $6.18 5934011400 $6.18 5934011500 $6.18 5934011600 $6.18 5934011700 $6.18 5934011800 $6.18 5934011900 $6.18 5934012000 $6.18 5934012100 $6.18 5934012200 $6.18 5934012300 $6.18 5934012400 $6.18 5934012500 $6.18 5934012600 $6.18 5934012700 $6.18 5934012800 $6.18 5934012900 $6.18 5934013000 $6.18 5934013100 $6.18 5934013200 $6.18 5934013300 $6.18 5934013400 $6.18 5934013500 $6.18 5934013600 $6.18 5941210100 $6.18 5941210200 $6.18 5941210300 $6.18 5941210400 $6.18 5941210500 $6.18 5941210600 $6.18 5941210700 $6.18 5941210800 $6.18 5941210900 $6.18 5941211000 $6.18 5941211100 $6.18 5941211200 $6.18 5941211300 $6.18 5941211400 $6.18 5941211500 $6.18 5941211600 $6.18 5941211700 $6.18 5941211800 $6.18 5941211900 $6.18 5941212000 $6.18 5941212100 $6.18 5941212200 $6.18 5941212300 $6.18 5941212700 $6.18 5941212800 $6.18 5941212900 $6.18 5941213000 $6.18 5941213100 $6.18 5941213200 $6.18 5941213300 $6.18 5941213400 $6.18 5941213500 $6.18 5941213600 $6.18 5941213700 $6.18 5941213800 $6.18 5941213900 $6.18 5941214000 $6.18 5941214100 $6.18 5941214200 $6.18 5941214300 $6.18 5941214400 $6.18 5941214500 $6.18 5941214600 $6.18 5941214700 $6.18 5941214800 $6.18 5941214900 $6.18 5941215000 $6.18 5941215100 $6.18 5941215200 $6.18 5941215300 $6.18 5941215400 $6.18 5941215500 $6.18 5941215600 $6.18 5941215700 $6.18 5941215800 $6.18 5941215900 $6.18 5941216000 $6.18 5941216100 $6.18 5941216200 $6.18 5941216300 $6.18 Page 69 of 189 City of Chula Vista Engineer's ReportPage 284 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5941216400 $6.18 5941216500 $6.18 5941216600 $6.18 5941216700 $6.18 5941216800 $6.18 5941216900 $6.18 5941217000 $6.18 5941217100 $6.18 5941217200 $6.18 5941217300 $6.18 5941217400 $6.18 5941217500 $6.18 5941217600 $6.18 5941217700 $6.18 5941218200 $6.18 5941218300 $6.18 5941218400 $6.18 5941220100 $6.18 5941220200 $6.18 5941220300 $6.18 5941220400 $6.18 5941220500 $6.18 5941220600 $6.18 5941220700 $6.18 5941220800 $6.18 5941220900 $6.18 5941221000 $6.18 5941221100 $6.18 5941221200 $6.18 5941221300 $6.18 5941221400 $6.18 5941221500 $6.18 5941221600 $6.18 5941221700 $6.18 5941221800 $6.18 5941221900 $6.18 5941222000 $6.18 5941222100 $6.18 5941222200 $6.18 5941222300 $6.18 5941222400 $6.18 5941222500 $6.18 5941222600 $6.18 5941222700 $6.18 5941222800 $6.18 5941222900 $6.18 5941223000 $6.18 5941223100 $6.18 5941223200 $6.18 5941223300 $6.18 5941223400 $6.18 5941223500 $6.18 5941223600 $6.18 5941223700 $6.18 5941223800 $6.18 5941223900 $6.18 5941224000 $6.18 5941224100 $6.18 5941224200 $6.18 5941224300 $6.18 5941224400 $6.18 5941224500 $6.18 5941224600 $6.18 5941224700 $6.18 5941224800 $6.18 5941224900 $6.18 5941225000 $6.18 5941225100 $6.18 5941225200 $6.18 5941225300 $6.18 5941225400 $6.18 5941225500 $6.18 5941225600 $6.18 5941225700 $6.18 5941225800 $6.18 5941225900 $6.18 5941226000 $6.18 5941226100 $6.18 5941226200 $6.18 5941226300 $6.18 5941226400 $6.18 5941226500 $6.18 5941226600 $6.18 5941226700 $6.18 5941226800 $6.18 5944300100 $6.18 5944300200 $6.18 5944300300 $6.18 5944300400 $6.18 5944300500 $6.18 5944300600 $6.18 5944300700 $6.18 5944300800 $6.18 5944300900 $6.18 5944301000 $6.18 5944301100 $6.18 5944301200 $6.18 5944301300 $6.18 5944301400 $6.18 5944301500 $6.18 5944301600 $6.18 5944301700 $6.18 5944301800 $6.18 5944301900 $6.18 5944302000 $6.18 5944302100 $6.18 5944302200 $6.18 5944302300 $6.18 5944302400 $6.18 5944302500 $6.18 5944302600 $6.18 5944302700 $6.18 5944302800 $6.18 5944302900 $6.18 5944303000 $6.18 5944303100 $6.18 5944303200 $6.18 5944303300 $6.18 5944303400 $6.18 5944303500 $6.18 5944303600 $6.18 5944303700 $6.18 5944303800 $6.18 5944303900 $6.18 5944304000 $6.18 5944304100 $6.18 5944304200 $6.18 5944304300 $6.18 5944304400 $6.18 5944304500 $6.18 5944304600 $6.18 5944304700 $6.18 5944304800 $6.18 5944304900 $6.18 5944305000 $6.18 5944305100 $6.18 5944305200 $6.18 5944305300 $6.18 5944305400 $6.18 5944305500 $6.18 5944305600 $6.18 Page 70 of 189 City of Chula Vista Engineer's ReportPage 285 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944305700 $6.18 5944305800 $6.18 5944305900 $6.18 5944306000 $6.18 5944306100 $6.18 5944306200 $6.18 5944306300 $6.18 5944310100 $6.18 5944310200 $6.18 5944310300 $6.18 5944310400 $6.18 5944310500 $6.18 5944310600 $6.18 5944310700 $6.18 5944310800 $6.18 5944310900 $6.18 5944311000 $6.18 5944311100 $6.18 5944311200 $6.18 5944311300 $6.18 5944311400 $6.18 5944311500 $6.18 5944311600 $6.18 5944311700 $6.18 5944311800 $6.18 5944311900 $6.18 5944312000 $6.18 5944312100 $6.18 5944312200 $6.18 5944312300 $6.18 5944312400 $6.18 5944312500 $6.18 5944312600 $6.18 5944312700 $6.18 5944312800 $6.18 5944312900 $6.18 5944313000 $6.18 5944313100 $6.18 5944313200 $6.18 5944313300 $6.18 5944313400 $6.18 5944313500 $6.18 5944313600 $6.18 5944313700 $6.18 5944313800 $6.18 5944313900 $6.18 5944314000 $6.18 5944314100 $6.18 5944314200 $6.18 5944314300 $6.18 5944314400 $6.18 5944314500 $6.18 5944314600 $6.18 5944314700 $6.18 5944314800 $6.18 5944320200 $6.18 5944320300 $6.18 5944320400 $6.18 5944320500 $6.18 5944320600 $6.18 5944320700 $6.18 5944320800 $6.18 5944320900 $6.18 5944321000 $6.18 5944321100 $6.18 5944321200 $6.18 5944321300 $6.18 5944321400 $6.18 5944321500 $6.18 5944321600 $6.18 5944321700 $6.18 5944321800 $6.18 5944321900 $6.18 5944322000 $6.18 5944322100 $6.18 5944322200 $6.18 5944322300 $6.18 5944322400 $6.18 5944322500 $6.18 5944322600 $6.18 5944322700 $6.18 5944322800 $6.18 5944322900 $6.18 5944323000 $6.18 5944323100 $6.18 5944323200 $6.18 5944323300 $6.18 5944323400 $6.18 5944323500 $6.18 5944323600 $6.18 5944323700 $6.18 5944323800 $6.18 5944323900 $6.18 5944324000 $6.18 5944324100 $6.18 5944324200 $6.18 5944324300 $6.18 5944324400 $6.18 5944324500 $6.18 5944324600 $6.18 5944324700 $6.18 5944324800 $6.18 5944324900 $6.18 5944325000 $6.18 5944325100 $6.18 5944325200 $6.18 5944325300 $6.18 5944325400 $6.18 5944325500 $6.18 5944325600 $6.18 5944325700 $6.18 5944325800 $6.18 5944325900 $6.18 5944326000 $6.18 5944326100 $6.18 5944326200 $6.18 5944326300 $6.18 5944326400 $6.18 5944326500 $6.18 5944326600 $6.18 5944326700 $6.18 5944326800 $6.18 5944326900 $6.18 5944327000 $6.18 5944327100 $6.18 5944327200 $6.18 5944327300 $6.18 5944327400 $6.18 5944327500 $6.18 5944327600 $6.18 5944327700 $6.18 5944327800 $6.18 5944327900 $6.18 5944328000 $6.18 5944328100 $6.18 5944328200 $6.18 5944328300 $6.18 5944328400 $6.18 5944328500 $6.18 5944328600 $6.18 5944328700 $6.18 Page 71 of 189 City of Chula Vista Engineer's ReportPage 286 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944330100 $6.18 5944330200 $6.18 5944330300 $6.18 5944330400 $6.18 5944330500 $6.18 5944330600 $6.18 5944330700 $6.18 5944330800 $6.18 5944330900 $6.18 5944331000 $6.18 5944331100 $6.18 5944331200 $6.18 5944331300 $6.18 5944331400 $6.18 5944331500 $6.18 5944331600 $6.18 5944331700 $6.18 5944331800 $6.18 5944331900 $6.18 5944332000 $6.18 5944332100 $6.18 5944332200 $6.18 5944332300 $6.18 5944332400 $6.18 5944332500 $6.18 5944332600 $6.18 5944332700 $6.18 5944332800 $6.18 5944332900 $6.18 5944333000 $6.18 5944333100 $6.18 5944333300 $6.18 5944333400 $6.18 5944333500 $6.18 5944333600 $6.18 5944333700 $6.18 5944333800 $6.18 5944333900 $6.18 5944334000 $6.18 5944334100 $6.18 5944334200 $6.18 5944334300 $6.18 5944334400 $6.18 5944334500 $6.18 5944334600 $6.18 5944334700 $6.18 5944334800 $6.18 5944334900 $6.18 5944335000 $6.18 5944335100 $6.18 5944335200 $6.18 5944335300 $6.18 5944335400 $6.18 5944335500 $6.18 5944335600 $6.18 5944335700 $6.18 5944335800 $6.18 5944335900 $6.18 5944336000 $6.18 5944336100 $6.18 5944336200 $6.18 5944336300 $6.18 5944336400 $6.18 5944336500 $6.18 5944336600 $6.18 5944336700 $6.18 5944336800 $6.18 5944336900 $6.18 5944337000 $6.18 5944337100 $6.18 5944337200 $6.18 5944337300 $6.18 5944337400 $6.18 5944337800 $6.18 6400210100 $6.18 6400210200 $6.18 6400210300 $6.18 6400210400 $6.18 6400210500 $6.18 6400210600 $6.18 6400210700 $6.18 6400210800 $6.18 6400211000 $6.18 6400211100 $6.18 6400211200 $6.18 6400211300 $6.18 6400211700 $6.18 6400211800 $6.18 6400211900 $6.18 6400212000 $6.18 6400212100 $6.18 6400212200 $6.18 6400212300 $6.18 6400212400 $6.18 6400212500 $6.18 6400212600 $6.18 6400212700 $6.18 6400212800 $6.18 6400212900 $6.18 6400213000 $6.18 6400213100 $6.18 6400213200 $6.18 6400213300 $6.18 6400213400 $6.18 6400213500 $6.18 6400213600 $6.18 6400213700 $6.18 6400213800 $6.18 6400213900 $6.18 6400214000 $6.18 6400214100 $6.18 6400214200 $6.18 6400214300 $6.18 6400214400 $6.18 6400214500 $6.18 6400214600 $6.18 6400214700 $6.18 6400214800 $6.18 6400214900 $6.18 6400215000 $6.18 6400215100 $6.18 6400215200 $6.18 6400215300 $6.18 6400215400 $6.18 6400215500 $6.18 6400215600 $6.18 6400215700 $6.18 6400215800 $6.18 6400215900 $6.18 6400216000 $6.18 6400216100 $6.18 6400216200 $6.18 6400220100 $6.18 6400220200 $6.18 6400220300 $6.18 6400220400 $6.18 6400220500 $6.18 6400220600 $6.18 6400220700 $6.18 6400220800 $6.18 6400220900 $6.18 Page 72 of 189 City of Chula Vista Engineer's ReportPage 287 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400221000 $6.18 6400221100 $6.18 6400221200 $6.18 6400221300 $6.18 6400221400 $6.18 6400221500 $6.18 6400221600 $6.18 6400221700 $6.18 6400221800 $6.18 6400221900 $6.18 6400222000 $6.18 6400222100 $6.18 6400222200 $6.18 6400222300 $6.18 6400222400 $6.18 6400222500 $6.18 6400222600 $6.18 6400222700 $6.18 6400222800 $6.18 6400222900 $6.18 6400223000 $6.18 6400223100 $6.18 6400223200 $6.18 6400223300 $6.18 6400223400 $6.18 6400223500 $6.18 6400223600 $6.18 6400223700 $6.18 6400223800 $6.18 6400223900 $6.18 6400224000 $6.18 6400224100 $6.18 6400224200 $6.18 6400224300 $6.18 6400224400 $6.18 6400224500 $6.18 6400224600 $6.18 6400224700 $6.18 6400224800 $6.18 6400224900 $6.18 6400225000 $6.18 6400225100 $6.18 6400225200 $6.18 6400225300 $6.18 6400225400 $6.18 6400225500 $6.18 6400225600 $6.18 6400225700 $6.18 6400225800 $6.18 6400225900 $6.18 6400226000 $6.18 6400230100 $6.18 6400230200 $6.18 6400230300 $6.18 6400230400 $6.18 6400230500 $6.18 6400230600 $6.18 6400230700 $6.18 6400230800 $6.18 6400230900 $6.18 6400231000 $6.18 6400231100 $6.18 6400231200 $6.18 6400231300 $6.18 6400231400 $6.18 6400231500 $6.18 6400231600 $6.18 6400231700 $6.18 6400231800 $6.18 6400231900 $6.18 6400232000 $6.18 6400232100 $6.18 6400232200 $6.18 6400232300 $6.18 6400232400 $6.18 6400232500 $6.18 6400232600 $6.18 6400232700 $6.18 6400232800 $6.18 6400232900 $6.18 6400233000 $6.18 6400233100 $6.18 6400233200 $6.18 6400233300 $6.18 6400233400 $6.18 6400233500 $6.18 6400233600 $6.18 6400233700 $6.18 6400233800 $6.18 6400233900 $6.18 6400234000 $6.18 6400234100 $6.18 6400234200 $6.18 6400234300 $6.18 6400234400 $6.18 6400234500 $6.18 6400234600 $6.18 6400234700 $6.18 6400310100 $6.18 6400310200 $6.18 6400310300 $6.18 6400310400 $6.18 6400310500 $6.18 6400310600 $6.18 6400310700 $6.18 6400310800 $6.18 6400310900 $6.18 6400311000 $6.18 6400311100 $6.18 6400311200 $6.18 6400311300 $6.18 6400311400 $6.18 6400311500 $6.18 6400311600 $6.18 6400311700 $6.18 6400311800 $6.18 6400311900 $6.18 6400312000 $6.18 6400312100 $6.18 6400312200 $6.18 6400312300 $6.18 6400312400 $6.18 6400312500 $6.18 6400312600 $6.18 6400312700 $6.18 6400312800 $6.18 6400312900 $6.18 6400313000 $6.18 6400313100 $6.18 6400313200 $6.18 6400313300 $6.18 6400313400 $6.18 6400313500 $6.18 6400313600 $6.18 6400313700 $6.18 6400313800 $6.18 6400313900 $6.18 6400314000 $6.18 6400314100 $6.18 6400314200 $6.18 6400314300 $6.18 Page 73 of 189 City of Chula Vista Engineer's ReportPage 288 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400314400 $6.18 6400314500 $6.18 6400314600 $6.18 6400314700 $6.18 6400314800 $6.18 6400314900 $6.18 6400315000 $6.18 6400315100 $6.18 6400315200 $6.18 6400315300 $6.18 6400315400 $6.18 6400315500 $6.18 6400320100 $6.18 6400320200 $6.18 6400320300 $6.18 6400320400 $6.18 6400320500 $6.18 6400320600 $6.18 6400320700 $6.18 6400320800 $6.18 6400320900 $6.18 6400321000 $6.18 6400321100 $6.18 6400321200 $6.18 6400321300 $6.18 6400321400 $6.18 6400321500 $6.18 6400321800 $6.18 6400321900 $6.18 6400322000 $6.18 6400322100 $6.18 6400322200 $6.18 6400322300 $6.18 6400322400 $6.18 6400322500 $6.18 6400322600 $6.18 6400322700 $6.18 6400322800 $6.18 6400322900 $6.18 6400323000 $6.18 6400323100 $6.18 6400323200 $6.18 6400323300 $6.18 6400323400 $6.18 6400323500 $6.18 6400323600 $6.18 6400323700 $6.18 6400323800 $6.18 6400323900 $6.18 6400324000 $6.18 6400324100 $6.18 6400324200 $6.18 6400324300 $6.18 6400324400 $6.18 6400324500 $6.18 6400324600 $6.18 6400324700 $6.18 6400324800 $6.18 6400324900 $6.18 6400325000 $6.18 6400325100 $6.18 6400325200 $6.18 6400325300 $6.18 6400325400 $6.18 6400325500 $6.18 6400325600 $6.18 6400325700 $6.18 6400325800 $6.18 6400325900 $6.18 6400326300 $6.18 6400326400 $6.18 6400330100 $6.18 6400330200 $6.18 6400330300 $6.18 6400330400 $6.18 6400330500 $6.18 6400330600 $6.18 6400330700 $6.18 6400330800 $6.18 6400330900 $6.18 6400331000 $6.18 6400331100 $6.18 6400331200 $6.18 6400331300 $6.18 6400331400 $6.18 6400331500 $6.18 6400331600 $6.18 6400331700 $6.18 6400331800 $6.18 6400331900 $6.18 6400332000 $6.18 6400332100 $6.18 6400332200 $6.18 6400332300 $6.18 6400332400 $6.18 6400332500 $6.18 6400332600 $6.18 6400332700 $6.18 6400332800 $6.18 6400332900 $6.18 6400333000 $6.18 6400333100 $6.18 6400333200 $6.18 6400333300 $6.18 6400333400 $6.18 6400333500 $6.18 6400333600 $6.18 6400333700 $6.18 6400333800 $6.18 6400333900 $6.18 6400334000 $6.18 6400334100 $6.18 6400334200 $6.18 6400334300 $6.18 6400334400 $6.18 6400334500 $6.18 6400334600 $6.18 6400334700 $6.18 6400334800 $6.18 6400334900 $6.18 6400335000 $6.18 6400335100 $6.18 6400335200 $6.18 6400335300 $6.18 6400335400 $6.18 6400335500 $6.18 6400335600 $6.18 6400335700 $6.18 6400335800 $6.18 6400335900 $6.18 6400336000 $6.18 6400336100 $6.18 6402910400 $135.34 6402910500 $100.12 6402910600 $168.72 6402911300 $1,247.20 6402921900 $168.72 6402922000 $398.62 6402923600 $1,059.94 6402923900 $111.86 6402924000 $88.98 Page 74 of 189 City of Chula Vista Engineer's ReportPage 289 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402924400 $35.22 6402924600 $351.04 6402924700 $92.70 6402924800 $92.70 6402925000 $1,307.16 6402925200 $171.38 6402925300 $68.54 6402930300 $233.62 6402930400 $282.44 6402930600 $95.16 6402931200 $102.58 6402931500 $128.54 6402931600 $81.58 6402931700 $70.44 6402932300 $333.74 6402932600 $117.42 6402932700 $241.64 6402932800 $341.02 6402933100 $276.88 6402933201 $6.86 6402933202 $6.86 6402933203 $6.86 6402933204 $6.86 6402933205 $6.86 6402933206 $6.86 6402933207 $6.86 6402933208 $6.86 6402933209 $6.86 6402933210 $6.86 6402933211 $6.86 6402933212 $6.86 6402933213 $6.86 6402933214 $6.86 6402933215 $6.86 6402933216 $6.86 6402933217 $6.86 6402933218 $6.86 6403100100 $6.18 6403100200 $6.18 6403100300 $6.18 6403100400 $6.18 6403100500 $6.18 6403100600 $6.18 6403100700 $6.18 6403100800 $6.18 6403100900 $6.18 6403101000 $6.18 6403101100 $6.18 6403101200 $6.18 6403101300 $6.18 6403101400 $6.18 6403101500 $6.18 6403101600 $6.18 6403101700 $6.18 6403101800 $6.18 6403101900 $6.18 6403102000 $6.18 6403102100 $6.18 6403102200 $6.18 6403102300 $6.18 6403102400 $6.18 6403102500 $6.18 6403102600 $6.18 6403102700 $6.18 6403102800 $6.18 6403102900 $6.18 6403103000 $6.18 6403103100 $6.18 6403103200 $6.18 6403103300 $6.18 6403103400 $6.18 6403103500 $6.18 6403103600 $6.18 6403103700 $6.18 6403103800 $6.18 6403103900 $6.18 6403104000 $6.18 6403104100 $6.18 6403104200 $6.18 6403104300 $6.18 6403104400 $6.18 6403104500 $6.18 6403104600 $6.18 6403104700 $6.18 6403104800 $6.18 6403104900 $6.18 6403105000 $6.18 6403105100 $6.18 6403105200 $6.18 6403105300 $6.18 6403105400 $6.18 6403105500 $6.18 6403105600 $6.18 6403105700 $6.18 6403105800 $6.18 6403105900 $6.18 6403106000 $6.18 6403106100 $6.18 6403106200 $6.18 6403106300 $6.18 6403106400 $6.18 6403106500 $6.18 6403106600 $6.18 6403106700 $6.18 6403106800 $6.18 6403106900 $6.18 6403107000 $6.18 6403107100 $6.18 6403107200 $6.18 6403107300 $6.18 6403107400 $6.18 6403107500 $6.18 6403107600 $6.18 6403107700 $6.18 6403107800 $6.18 6403107900 $6.18 6403108000 $6.18 6403108100 $6.18 6403108200 $6.18 6403108300 $6.18 6403108400 $6.18 6403108500 $6.18 6403108600 $6.18 6403108700 $6.18 6403108800 $6.18 6403108900 $6.18 6403109000 $6.18 6403109100 $6.18 6403110100 $6.18 6403110200 $6.18 6403110300 $6.18 6403110400 $6.18 6403110500 $6.18 6403110600 $6.18 6403110700 $6.18 6403110800 $6.18 6403110900 $6.18 6403111000 $6.18 6403111100 $6.18 6403111200 $6.18 6403111300 $6.18 Page 75 of 189 City of Chula Vista Engineer's ReportPage 290 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403111400 $6.18 6403111500 $6.18 6403111600 $6.18 6403111700 $6.18 6403111800 $6.18 6403111900 $6.18 6403112000 $6.18 6403112100 $6.18 6403112200 $6.18 6403112300 $6.18 6403112400 $6.18 6403112500 $6.18 6403112600 $6.18 6403112700 $6.18 6403112800 $6.18 6403112900 $6.18 6403113000 $6.18 6403113100 $6.18 6403113200 $6.18 6403113300 $6.18 6403113400 $6.18 6403113500 $6.18 6403113600 $6.18 6403113700 $6.18 6403113800 $6.18 6403113900 $6.18 6403114000 $6.18 6403114100 $6.18 6403114200 $6.18 6403114300 $6.18 6403114400 $6.18 6403114500 $6.18 6403114600 $6.18 6403114700 $6.18 6403114800 $6.18 6403114900 $6.18 6403115000 $6.18 6403115100 $6.18 6403115200 $6.18 6403115300 $6.18 6403115400 $6.18 6403115500 $6.18 6403115600 $6.18 6403115700 $6.18 6403115800 $6.18 6403115900 $6.18 6403116000 $6.18 6403116100 $6.18 6403116200 $6.18 6403116300 $6.18 6403116400 $6.18 6403116500 $6.18 6403116600 $6.18 6403116700 $6.18 6403116800 $6.18 6403116900 $6.18 6403117000 $6.18 6403117100 $6.18 6403117200 $6.18 6403117300 $6.18 6403117400 $6.18 6403117500 $6.18 6403117600 $6.18 6403210100 $6.18 6403210200 $6.18 6403210300 $6.18 6403210400 $6.18 6403210500 $6.18 6403210600 $6.18 6403210700 $6.18 6403210800 $6.18 6403210900 $6.18 6403211000 $6.18 6403211100 $6.18 6403211200 $6.18 6403211300 $6.18 6403211400 $6.18 6403211500 $6.18 6403211600 $6.18 6403211700 $6.18 6403211800 $6.18 6403211900 $6.18 6403212000 $6.18 6403212100 $6.18 6403212200 $6.18 6403212300 $6.18 6403212400 $6.18 6403220100 $6.18 6403220200 $6.18 6403220300 $6.18 6403220400 $6.18 6403220500 $6.18 6403220600 $6.18 6403220700 $6.18 6403220800 $6.18 6403220900 $6.18 6403221000 $6.18 6403221100 $6.18 6403221200 $6.18 6403221300 $6.18 6403221400 $6.18 6403221500 $6.18 6403221600 $6.18 6403221700 $6.18 6403221800 $6.18 6403221900 $6.18 6403222000 $6.18 6403222100 $6.18 6403222200 $6.18 6403222300 $6.18 6403222400 $6.18 6403222500 $6.18 6403222600 $6.18 6403222700 $6.18 6403222800 $6.18 6403222900 $6.18 6403223000 $6.18 6403223100 $6.18 6403223200 $6.18 6403223300 $6.18 6403223400 $6.18 6403223500 $6.18 6403223600 $6.18 6403223700 $6.18 6403223800 $6.18 6403223900 $6.18 6403224000 $6.18 6403224100 $6.18 6403224200 $6.18 6403230100 $6.18 6403230200 $6.18 6403230300 $6.18 6403230400 $6.18 6403230500 $6.18 6403230600 $6.18 6403230700 $6.18 6403230800 $6.18 6403230900 $6.18 6403231000 $6.18 6403231100 $6.18 6403231200 $6.18 Page 76 of 189 City of Chula Vista Engineer's ReportPage 291 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403231300 $6.18 6403231400 $6.18 6403231500 $6.18 6403231600 $6.18 6403231700 $6.18 6403231800 $6.18 6403231900 $6.18 6403232000 $6.18 6403232100 $6.18 6403232200 $6.18 6403232300 $6.18 6403232400 $6.18 6403232500 $6.18 6403232600 $6.18 6403232700 $6.18 6403232800 $6.18 6403232900 $6.18 6403233000 $6.18 6403233100 $6.18 6403233200 $6.18 6403233300 $6.18 6403233400 $6.18 6403233500 $6.18 6403233600 $6.18 6403233700 $6.18 6403233800 $6.18 6403233900 $6.18 6403234000 $6.18 6403300101 $6.18 6403300102 $6.18 6403300103 $6.18 6403300104 $6.18 6403300105 $6.18 6403300106 $6.18 6403300107 $6.18 6403300108 $6.18 6403300109 $6.18 6403300110 $6.18 6403300111 $6.18 6403300201 $6.18 6403300202 $6.18 6403300203 $6.18 6403300204 $6.18 6403300205 $6.18 6403300206 $6.18 6403300207 $6.18 6403300301 $6.18 6403300302 $6.18 6403300303 $6.18 6403300304 $6.18 6403300305 $6.18 6403300306 $6.18 6403300307 $6.18 6403300308 $6.18 6403300401 $6.18 6403300402 $6.18 6403300403 $6.18 6403300404 $6.18 6403300405 $6.18 6403300406 $6.18 6403300407 $6.18 6403300408 $6.18 6403300501 $6.18 6403300502 $6.18 6403300503 $6.18 6403300504 $6.18 6403300505 $6.18 6403300506 $6.18 6403300601 $6.18 6403300602 $6.18 6403300603 $6.18 6403300604 $6.18 6403300605 $6.18 6403300606 $6.18 6403300701 $6.18 6403300702 $6.18 6403300703 $6.18 6403300704 $6.18 6403300705 $6.18 6403300706 $6.18 6403300707 $6.18 6403301101 $6.18 6403301102 $6.18 6403301103 $6.18 6403301104 $6.18 6403301105 $6.18 6403301106 $6.18 6403301107 $6.18 6403301201 $6.18 6403301202 $6.18 6403301203 $6.18 6403301204 $6.18 6403301205 $6.18 6403301206 $6.18 6403301207 $6.18 6403301301 $6.18 6403301302 $6.18 6403301303 $6.18 6403301304 $6.18 6403301305 $6.18 6403301306 $6.18 6403301307 $6.18 6403301401 $6.18 6403301402 $6.18 6403301403 $6.18 6403301404 $6.18 6403301405 $6.18 6403301406 $6.18 6403301407 $6.18 6403301408 $6.18 6403301409 $6.18 6403301501 $6.18 6403301502 $6.18 6403301503 $6.18 6403301504 $6.18 6403301505 $6.18 6403301506 $6.18 6403301507 $6.18 6403301601 $6.18 6403301602 $6.18 6403301603 $6.18 6403301604 $6.18 6403301605 $6.18 6403301606 $6.18 6403301607 $6.18 6403301608 $6.18 6403301701 $6.18 6403301702 $6.18 6403301703 $6.18 6403301704 $6.18 6403301705 $6.18 6403301706 $6.18 6403301707 $6.18 6403301801 $6.18 6403301802 $6.18 6403301803 $6.18 6403301804 $6.18 6403301805 $6.18 6403301806 $6.18 6403301807 $6.18 6403301808 $6.18 Page 77 of 189 City of Chula Vista Engineer's ReportPage 292 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403301901 $6.18 6403301902 $6.18 6403301903 $6.18 6403301904 $6.18 6403301905 $6.18 6403301906 $6.18 6403301907 $6.18 6403301908 $6.18 6403302001 $6.18 6403302002 $6.18 6403302003 $6.18 6403302004 $6.18 6403302005 $6.18 6403302101 $6.18 6403302102 $6.18 6403302103 $6.18 6403302104 $6.18 6403302105 $6.18 6403302106 $6.18 6403302107 $6.18 6403302108 $6.18 6403302201 $6.18 6403302202 $6.18 6403302203 $6.18 6403302204 $6.18 6403302205 $6.18 6403302206 $6.18 6403302207 $6.18 6403302301 $6.18 6403302302 $6.18 6403302303 $6.18 6403302304 $6.18 6403302305 $6.18 6403302306 $6.18 6403302401 $6.18 6403302402 $6.18 6403302403 $6.18 6403302404 $6.18 6403302405 $6.18 6403302406 $6.18 6403302407 $6.18 6403302501 $6.18 6403302502 $6.18 6403302503 $6.18 6403302504 $6.18 6403302505 $6.18 6403302506 $6.18 6403302507 $6.18 6403302508 $6.18 6403302601 $6.18 6403302602 $6.18 6403302603 $6.18 6403302604 $6.18 6403302605 $6.18 6403302606 $6.18 6403302607 $6.18 6403302608 $6.18 6403302701 $6.18 6403302702 $6.18 6403302703 $6.18 6403302704 $6.18 6403302705 $6.18 6403302706 $6.18 6403302707 $6.18 6403304201 $6.18 6403304202 $6.18 6403304203 $6.18 6403304204 $6.18 6403304205 $6.18 6403304206 $6.18 6403304207 $6.18 6403304301 $6.18 6403304302 $6.18 6403304303 $6.18 6403304304 $6.18 6403304305 $6.18 6403304306 $6.18 6403304307 $6.18 6403304308 $6.18 6403304309 $6.18 6403304401 $6.18 6403304402 $6.18 6403304403 $6.18 6403304404 $6.18 6403304405 $6.18 6403304406 $6.18 6403304407 $6.18 6423800401 $6.18 6423800402 $6.18 6423800403 $6.18 6423800404 $6.18 6423800405 $6.18 6423800406 $6.18 6423800407 $6.18 6423800408 $6.18 6423800409 $6.18 6423800410 $6.18 6423800411 $6.18 6423800412 $6.18 6423800413 $6.18 6423800414 $6.18 6423800415 $6.18 6423800416 $6.18 6423800417 $6.18 6423800418 $6.18 6423800419 $6.18 6423800420 $6.18 6423800421 $6.18 6423800422 $6.18 6423800423 $6.18 6423800424 $6.18 6423800425 $6.18 6423800426 $6.18 6423800427 $6.18 6423800501 $6.18 6423800502 $6.18 6423800503 $6.18 6423800504 $6.18 6423800505 $6.18 6423800506 $6.18 6423800507 $6.18 6423800508 $6.18 6423800509 $6.18 6423800510 $6.18 6423800511 $6.18 6423800512 $6.18 6423800513 $6.18 6423800514 $6.18 6423800515 $6.18 6423800516 $6.18 6423800517 $6.18 6423800518 $6.18 6423800519 $6.18 6423800520 $6.18 6423800521 $6.18 6423800601 $6.18 6423800602 $6.18 6423800603 $6.18 6423800604 $6.18 6423800605 $6.18 6423800606 $6.18 Page 78 of 189 City of Chula Vista Engineer's ReportPage 293 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423800607 $6.18 6423800608 $6.18 6423800609 $6.18 6423800610 $6.18 6423800611 $6.18 6423800612 $6.18 6423800613 $6.18 6423800614 $6.18 6423800615 $6.18 6423800616 $6.18 6423800617 $6.18 6423800618 $6.18 6423800619 $6.18 6423800701 $6.18 6423800702 $6.18 6423800703 $6.18 6423800704 $6.18 6423800705 $6.18 6423800706 $6.18 6423800707 $6.18 6423800708 $6.18 6423800709 $6.18 6423800710 $6.18 6423800711 $6.18 6423800712 $6.18 6423800713 $6.18 6423800714 $6.18 6423800715 $6.18 6423800716 $6.18 6423800717 $6.18 6423800718 $6.18 6423800719 $6.18 6423800720 $6.18 6423800721 $6.18 6423800722 $6.18 6423801001 $6.18 6423801002 $6.18 6423801003 $6.18 6423801101 $6.18 6423801102 $6.18 6423801103 $6.18 6423801104 $6.18 6423801105 $6.18 6423801501 $6.18 6423801502 $6.18 6423801503 $6.18 6423801504 $6.18 6423801505 $6.18 6423801506 $6.18 6423801507 $6.18 6423801508 $6.18 6423801509 $6.18 6423801510 $6.18 6423801511 $6.18 6423801512 $6.18 6423801513 $6.18 6423801514 $6.18 6423801515 $6.18 6423801516 $6.18 6423801517 $6.18 6423801601 $6.18 6423801602 $6.18 6423801603 $6.18 6423801604 $6.18 6423801605 $6.18 6423801606 $6.18 6423801607 $6.18 6423801608 $6.18 6423801609 $6.18 6423801610 $6.18 6423801611 $6.18 6423801612 $6.18 6423801613 $6.18 6423801614 $6.18 6423801615 $6.18 6423801701 $6.18 6423801702 $6.18 6423801703 $6.18 6423801704 $6.18 6423801705 $6.18 6423801706 $6.18 6423801707 $6.18 6423801708 $6.18 6423801709 $6.18 6423801710 $6.18 6423801711 $6.18 6423801712 $6.18 6423801713 $6.18 6423801714 $6.18 6423801715 $6.18 6423801716 $6.18 6423801717 $6.18 6423801718 $6.18 6423920100 $587.14 6423920200 $457.34 6423920300 $364.64 6423921200 $889.98 6423921300 $791.08 6424100101 $6.18 6424100102 $6.18 6424100103 $6.18 6424100104 $6.18 6424100105 $6.18 6424100106 $6.18 6424100107 $6.18 6424100108 $6.18 6424100109 $6.18 6424100110 $6.18 6424100111 $6.18 6424100112 $6.18 6424100113 $6.18 6424100114 $6.18 6424100115 $6.18 6424100116 $6.18 6424100117 $6.18 6424100118 $6.18 6424100119 $6.18 6424100120 $6.18 6424100121 $6.18 6424100122 $6.18 6424100123 $6.18 6424100124 $6.18 6424100301 $6.18 6424100302 $6.18 6424100303 $6.18 6424100304 $6.18 6424100305 $6.18 6424100306 $6.18 6424100307 $6.18 6424100308 $6.18 6424100309 $6.18 6424100310 $6.18 6424100311 $6.18 6424100312 $6.18 6424100313 $6.18 6424100314 $6.18 6424100315 $6.18 6424100316 $6.18 6424100317 $6.18 6424100318 $6.18 6424100319 $6.18 Page 79 of 189 City of Chula Vista Engineer's ReportPage 294 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-76 - OSD 20 Zone 2 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6424100320 $6.18 6424100321 $6.18 6424100322 $6.18 6424100323 $6.18 6424100324 $6.18 6424100325 $6.18 6424100701 $6.18 6424100702 $6.18 6424100703 $6.18 6424100704 $6.18 6424100705 $6.18 6424100706 $6.18 6424100707 $6.18 6424100708 $6.18 6424100709 $6.18 6424100710 $6.18 6424100711 $6.18 6424100712 $6.18 6424100713 $6.18 6424100801 $6.18 6424100802 $6.18 6424100803 $6.18 6424100804 $6.18 6424100805 $6.18 6424100806 $6.18 6424100807 $6.18 6424100808 $6.18 6424100809 $6.18 6424100810 $6.18 6424100811 $6.18 6424100812 $6.18 6424100813 $6.18 6424100814 $6.18 6424100815 $6.18 6424100816 $6.18 6424100817 $6.18 6424100818 $6.18 6424100819 $6.18 6424101301 $6.18 6424101302 $6.18 6424101303 $6.18 6424101304 $6.18 6424101305 $6.18 6424101306 $6.18 6424101307 $6.18 6424101308 $6.18 6424101401 $6.18 6424101402 $6.18 6424101403 $6.18 6424101404 $6.18 6424101405 $6.18 6424101406 $6.18 6424101407 $6.18 6424101408 $6.18 6424101409 $6.18 6424101410 $6.18 6424101411 $6.18 6424101412 $6.18 6424101413 $6.18 6424101414 $6.18 6424101415 $6.18 6424101416 $6.18 6424101501 $6.18 6424101502 $6.18 6424101503 $6.18 6424101504 $6.18 6424101505 $6.18 6424101506 $6.18 6424101507 $6.18 6424101508 $6.18 6424101509 $6.18 6424101510 $6.18 6424101511 $6.18 6424101512 $6.18 6424101513 $6.18 6424101514 $6.18 6424101515 $6.18 6424101516 $6.18 6424101517 $6.18 6424101518 $6.18 6424101601 $6.18 6424101602 $6.18 6424101603 $6.18 6424101604 $6.18 6424101605 $6.18 6424101606 $6.18 6424101607 $6.18 6424101608 $6.18 6424101609 $6.18 6424101610 $6.18 6424101611 $6.18 6424101612 $6.18 6424101613 $6.18 6424101614 $6.18 6424101615 $6.18 Totals Parcels 2,210 Levy $24,459.58 Page 80 of 189 City of Chula Vista Engineer's ReportPage 295 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5931410100 $8.80 5931410200 $8.80 5931410300 $8.80 5931410400 $8.80 5931410500 $8.80 5931410600 $8.80 5931410700 $8.80 5931410800 $8.80 5931410900 $8.80 5931411000 $8.80 5931411100 $8.80 5931411200 $8.80 5931411300 $8.80 5931411400 $8.80 5931411500 $8.80 5931411600 $8.80 5931411700 $8.80 5931411800 $8.80 5931411900 $8.80 5931412000 $8.80 5931412100 $8.80 5931420100 $8.80 5931420200 $8.80 5931420300 $8.80 5931420400 $8.80 5931420500 $8.80 5931420600 $8.80 5931420700 $8.80 5931420800 $8.80 5931420900 $8.80 5931421000 $8.80 5931421100 $8.80 5931421200 $8.80 5931421300 $8.80 5931421400 $8.80 5931421500 $8.80 5931421600 $8.80 5931421700 $8.80 5931421800 $8.80 5931421900 $8.80 5931422000 $8.80 5931422100 $8.80 5931422200 $8.80 5931422300 $8.80 5931422400 $8.80 5931422500 $8.80 5931422600 $8.80 5931422700 $8.80 5931422800 $8.80 5931422900 $8.80 5931423000 $8.80 5931423100 $8.80 5931423200 $8.80 5931423300 $8.80 5931423400 $8.80 5931423500 $8.80 5931430100 $8.80 5931430300 $8.80 5931430400 $8.80 5931430500 $8.80 5931430600 $8.80 5931430700 $8.80 5931430800 $8.80 5931430900 $8.80 5931431000 $8.80 5931431100 $8.80 5931431200 $8.80 5931431300 $8.80 5931431400 $8.80 5931431500 $8.80 5931431600 $8.80 5931431700 $8.80 5931431800 $8.80 5931431900 $8.80 5931432000 $8.80 5931432100 $8.80 5931432200 $8.80 5931432600 $8.80 5933600100 $8.80 5933600200 $8.80 5933600300 $8.80 5933600400 $8.80 5933600500 $8.80 5933600600 $8.80 5933600700 $8.80 5933600800 $8.80 5933600900 $8.80 5933601000 $8.80 5933601100 $8.80 5933601200 $8.80 5933601300 $8.80 5933601400 $8.80 5933601500 $8.80 5933601600 $8.80 5933601700 $8.80 5933601800 $8.80 5933601900 $8.80 5933602000 $8.80 5933602100 $8.80 5933602200 $8.80 5933602300 $8.80 5933602400 $8.80 5933602500 $8.80 5933602600 $8.80 5933602700 $8.80 5933602800 $8.80 5933602900 $8.80 5933603000 $8.80 5933603100 $8.80 5933610100 $8.80 5933610200 $8.80 5933610300 $8.80 5933610400 $8.80 5933610500 $8.80 5933610600 $8.80 5933610700 $8.80 5933610800 $8.80 5933610900 $8.80 5933611000 $8.80 5933611100 $8.80 5933611200 $8.80 5933611300 $8.80 5933611400 $8.80 5933611500 $8.80 5933611600 $8.80 5933611700 $8.80 5933611800 $8.80 5933611900 $8.80 5933612000 $8.80 5933612100 $8.80 5933612200 $8.80 5933612300 $8.80 5933612400 $8.80 5933612500 $8.80 5933612600 $8.80 5933612700 $8.80 5933612800 $8.80 5933612900 $8.80 5933620100 $8.80 5933620200 $8.80 5933620300 $8.80 Assessment Roll Page 81 of 189 City of Chula Vista Engineer's ReportPage 296 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933620400 $8.80 5933620500 $8.80 5933620600 $8.80 5933620700 $8.80 5933620800 $8.80 5933620900 $8.80 5933621000 $8.80 5933621100 $8.80 5933621200 $8.80 5933621300 $8.80 5933621400 $8.80 5933621500 $8.80 5933621600 $8.80 5933621700 $8.80 5933622200 $8.80 5933622300 $8.80 5933700100 $8.80 5933700200 $8.80 5933700300 $8.80 5933700400 $8.80 5933700500 $8.80 5933700600 $8.80 5933700700 $8.80 5933700800 $8.80 5933700900 $8.80 5933701000 $8.80 5933701100 $8.80 5933701200 $8.80 5933701300 $8.80 5933701400 $8.80 5933701500 $8.80 5933701600 $8.80 5933701700 $8.80 5933701800 $8.80 5933701900 $8.80 5933702000 $8.80 5933702100 $8.80 5933702200 $8.80 5933702300 $8.80 5933702400 $8.80 5933702500 $8.80 5933702600 $8.80 5933702700 $8.80 5933702800 $8.80 5933702900 $8.80 5933703000 $8.80 5933703100 $8.80 5933703200 $8.80 5933703300 $8.80 5933703400 $8.80 5933703500 $8.80 5933703600 $8.80 5933703700 $8.80 5933703800 $8.80 5933703900 $8.80 5933704000 $8.80 5933704100 $8.80 5933704200 $8.80 5933704300 $8.80 5933704400 $8.80 5933704500 $8.80 5933704600 $8.80 5933704700 $8.80 5933704800 $8.80 5933710100 $8.80 5933710200 $8.80 5933710300 $8.80 5933710400 $8.80 5933710500 $8.80 5933710600 $8.80 5933710700 $8.80 5933710800 $8.80 5933710900 $8.80 5933711000 $8.80 5933711100 $8.80 5933711200 $8.80 5933711300 $8.80 5933711400 $8.80 5933711500 $8.80 5933711600 $8.80 5933711700 $8.80 5933711800 $8.80 5933711900 $8.80 5933712000 $8.80 5933712100 $8.80 5933712200 $8.80 5933712300 $8.80 5933712400 $8.80 5933712500 $8.80 5933712600 $8.80 5933712700 $8.80 5933712800 $8.80 5933712900 $8.80 5933713000 $8.80 5933713100 $8.80 5933713200 $8.80 5933713300 $8.80 5933713400 $8.80 5933713500 $8.80 5933713600 $8.80 5933713700 $8.80 5933713800 $8.80 5933713900 $8.80 5933714000 $8.80 5933714100 $8.80 5933714200 $8.80 5933714300 $8.80 5933714400 $8.80 5933714500 $8.80 5933714600 $8.80 5933714700 $8.80 5933714800 $8.80 5933714900 $8.80 5933715000 $8.80 5933715100 $8.80 5933715200 $8.80 5933715300 $8.80 5933715400 $8.80 5933715500 $8.80 5933715600 $8.80 5933715700 $8.80 5933715800 $8.80 5933715900 $8.80 5933716000 $8.80 5933716100 $8.80 5933716200 $8.80 5933716300 $8.80 5933716400 $8.80 5933716500 $8.80 5933716600 $8.80 5933716700 $8.80 5933716800 $8.80 5933716900 $8.80 5933717000 $8.80 5933717100 $8.80 5933717200 $8.80 5933717300 $8.80 5933717500 $8.80 5933717600 $8.80 5933717700 $8.80 5933717800 $8.80 Page 82 of 189 City of Chula Vista Engineer's ReportPage 297 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933717900 $8.80 5933718000 $8.80 5933718100 $8.80 5933718200 $8.80 5933718300 $8.80 5933718400 $8.80 5933718500 $8.80 5933720100 $8.80 5933720200 $8.80 5933720300 $8.80 5933720400 $8.80 5933720500 $8.80 5933720600 $8.80 5933720700 $8.80 5933720800 $8.80 5933720900 $8.80 5933721000 $8.80 5933721100 $8.80 5933721200 $8.80 5933721300 $8.80 5933721400 $8.80 5933721500 $8.80 5933721600 $8.80 5933721700 $8.80 5933721800 $8.80 5933721900 $8.80 5933722000 $8.80 5933722100 $8.80 5933722200 $8.80 5933722300 $8.80 5933722400 $8.80 5933722500 $8.80 5933722600 $8.80 5933722700 $8.80 5933722800 $8.80 5933722900 $8.80 5933723000 $8.80 5933723100 $8.80 5933723200 $8.80 5933723300 $8.80 5933723400 $8.80 5933723500 $8.80 5933723600 $8.80 5933723700 $8.80 5933723800 $8.80 5933723900 $8.80 5933724000 $8.80 5933724100 $8.80 5933724200 $8.80 5933724300 $8.80 5933724400 $8.80 5933724500 $8.80 5933724600 $8.80 5933724700 $8.80 5933724800 $8.80 5933724900 $8.80 5933725000 $8.80 5933725100 $8.80 5933725200 $8.80 5933725300 $8.80 5933725400 $8.80 5933725500 $8.80 5933725600 $8.80 5933730100 $8.80 5933730200 $8.80 5933730300 $8.80 5933730400 $8.80 5933730500 $8.80 5933730600 $8.80 5933730700 $8.80 5933730800 $8.80 5933730900 $8.80 5933731000 $8.80 5933731100 $8.80 5933731200 $8.80 5933731300 $8.80 5933731400 $8.80 5933731500 $8.80 5933731600 $8.80 5933731700 $8.80 5933731800 $8.80 5933731900 $8.80 5933732000 $8.80 5933732100 $8.80 5933732200 $8.80 5933732300 $8.80 5933732400 $8.80 5933732500 $8.80 5933732600 $8.80 5933732700 $8.80 5933732800 $8.80 5933732900 $8.80 5933733000 $8.80 5933733100 $8.80 5933733200 $8.80 5933733300 $8.80 5933733400 $8.80 5933733500 $8.80 5933733600 $8.80 5933733700 $8.80 5933733800 $8.80 5933733900 $8.80 5933734000 $8.80 5933734100 $8.80 5933734200 $8.80 5933734300 $8.80 5933734400 $8.80 5933734500 $8.80 5933734600 $8.80 5933734700 $8.80 5933734800 $8.80 5933734900 $8.80 5933735000 $8.80 5933735100 $8.80 5933735200 $8.80 5933735300 $8.80 5933735400 $8.80 5933735500 $8.80 5933735600 $8.80 5933735700 $8.80 5933735800 $8.80 5933735900 $8.80 5933736000 $8.80 5933736100 $8.80 5933800100 $8.80 5933800200 $8.80 5933800300 $8.80 5933800400 $8.80 5933800500 $8.80 5933800600 $8.80 5933800700 $8.80 5933800800 $8.80 5933800900 $8.80 5933801000 $8.80 5933801100 $8.80 5933801200 $8.80 5933801300 $8.80 5933801400 $8.80 5933801500 $8.80 5933801600 $8.80 5933801700 $8.80 Page 83 of 189 City of Chula Vista Engineer's ReportPage 298 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933801800 $8.80 5933801900 $8.80 5933802000 $8.80 5933802100 $8.80 5933802200 $8.80 5933802300 $8.80 5933802400 $8.80 5933802500 $8.80 5933802600 $8.80 5933802700 $8.80 5933802800 $8.80 5933802900 $8.80 5933803000 $8.80 5933803100 $8.80 5933803200 $8.80 5933803300 $8.80 5933810100 $8.80 5933810200 $8.80 5933810300 $8.80 5933810400 $8.80 5933810500 $8.80 5933810600 $8.80 5933810700 $8.80 5933810800 $8.80 5933810900 $8.80 5933811000 $8.80 5933811100 $8.80 5933811200 $8.80 5933811300 $8.80 5933811400 $8.80 5933811500 $8.80 5933811600 $8.80 5933811700 $8.80 5933811800 $8.80 5933811900 $8.80 5933812000 $8.80 5933812100 $8.80 5933812200 $8.80 5933812300 $8.80 5933812400 $8.80 5933812500 $8.80 5933812600 $8.80 5933812700 $8.80 5933812800 $8.80 5933812900 $8.80 5933813000 $8.80 5933813100 $8.80 5933813200 $8.80 5933813300 $8.80 5933813400 $8.80 5933813500 $8.80 5933813600 $8.80 5933813700 $8.80 5933820100 $8.80 5933820200 $8.80 5933820300 $8.80 5933820400 $8.80 5933820500 $8.80 5933820600 $8.80 5933820700 $8.80 5933820800 $8.80 5933820900 $8.80 5933821000 $8.80 5933821100 $8.80 5933821200 $8.80 5933821300 $8.80 5933821400 $8.80 5933821500 $8.80 5933821600 $8.80 5933821700 $8.80 5933821800 $8.80 5933821900 $8.80 5933822000 $8.80 5933822100 $8.80 5933822200 $8.80 5933822300 $8.80 5933822400 $8.80 5933822500 $8.80 5933822600 $8.80 5933822700 $8.80 5933822800 $8.80 5933822900 $8.80 5933823000 $8.80 5933823100 $8.80 5933823200 $8.80 5933823300 $8.80 5933823400 $8.80 5933823500 $8.80 5933823600 $8.80 5933823700 $8.80 5933823800 $43.98 5933824100 $8.38 5933900100 $8.80 5933900200 $8.80 5933900300 $8.80 5933900400 $8.80 5933900500 $8.80 5933900600 $8.80 5933900700 $8.80 5933900800 $8.80 5933900900 $8.80 5933901000 $8.80 5933901100 $8.80 5933901200 $8.80 5933901300 $8.80 5933901400 $8.80 5933901500 $8.80 5933901600 $8.80 5933901700 $8.80 5933901800 $8.80 5933901900 $8.80 5933902000 $8.80 5933902100 $8.80 5933902200 $8.80 5933902300 $8.80 5933902400 $8.80 5933902500 $8.80 5933902600 $8.80 5933902700 $8.80 5933910100 $8.80 5933910200 $8.80 5933910300 $8.80 5933910400 $8.80 5933910500 $8.80 5933910600 $8.80 5933910700 $8.80 5933910800 $8.80 5933910900 $8.80 5933911000 $8.80 5933911100 $8.80 5933911200 $8.80 5933911300 $8.80 5933911400 $8.80 5933911500 $8.80 5933911600 $8.80 5933911700 $8.80 5933911800 $8.80 5933911900 $8.80 5933912000 $8.80 5933912100 $8.80 5933912200 $8.80 Page 84 of 189 City of Chula Vista Engineer's ReportPage 299 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933912300 $8.80 5933912400 $8.80 5933912500 $8.80 5933912600 $8.80 5933912700 $8.80 5933912800 $8.80 5933912900 $8.80 5933913000 $8.80 5933920100 $8.80 5933920400 $8.80 5933920500 $8.80 5933920600 $8.80 5933920700 $8.80 5933920800 $8.80 5933920900 $8.80 5933921000 $8.80 5933921100 $8.80 5933921200 $8.80 5933921600 $8.80 5933922000 $8.80 5934000100 $8.80 5934000200 $8.80 5934000300 $8.80 5934000400 $8.80 5934000500 $8.80 5934000600 $8.80 5934000700 $8.80 5934000800 $8.80 5934000900 $8.80 5934001000 $8.80 5934001100 $8.80 5934001200 $8.80 5934001300 $8.80 5934001400 $8.80 5934001500 $8.80 5934001600 $8.80 5934001700 $8.80 5934001800 $8.80 5934001900 $8.80 5934002000 $8.80 5934002100 $8.80 5934002200 $8.80 5934002300 $8.80 5934002400 $8.80 5934002500 $8.80 5934002600 $8.80 5934002700 $8.80 5934010100 $8.80 5934010200 $8.80 5934010300 $8.80 5934010400 $8.80 5934010500 $8.80 5934010600 $8.80 5934010700 $8.80 5934010800 $8.80 5934010900 $8.80 5934011000 $8.80 5934011100 $8.80 5934011200 $8.80 5934011300 $8.80 5934011400 $8.80 5934011500 $8.80 5934011600 $8.80 5934011700 $8.80 5934011800 $8.80 5934011900 $8.80 5934012000 $8.80 5934012100 $8.80 5934012200 $8.80 5934012300 $8.80 5934012400 $8.80 5934012500 $8.80 5934012600 $8.80 5934012700 $8.80 5934012800 $8.80 5934012900 $8.80 5934013000 $8.80 5934013100 $8.80 5934013200 $8.80 5934013300 $8.80 5934013400 $8.80 5934013500 $8.80 5934013600 $8.80 5941210100 $8.80 5941210200 $8.80 5941210300 $8.80 5941210400 $8.80 5941210500 $8.80 5941210600 $8.80 5941210700 $8.80 5941210800 $8.80 5941210900 $8.80 5941211000 $8.80 5941211100 $8.80 5941211200 $8.80 5941211300 $8.80 5941211400 $8.80 5941211500 $8.80 5941211600 $8.80 5941211700 $8.80 5941211800 $8.80 5941211900 $8.80 5941212000 $8.80 5941212100 $8.80 5941212200 $8.80 5941212300 $8.80 5941212700 $8.80 5941212800 $8.80 5941212900 $8.80 5941213000 $8.80 5941213100 $8.80 5941213200 $8.80 5941213300 $8.80 5941213400 $8.80 5941213500 $8.80 5941213600 $8.80 5941213700 $8.80 5941213800 $8.80 5941213900 $8.80 5941214000 $8.80 5941214100 $8.80 5941214200 $8.80 5941214300 $8.80 5941214400 $8.80 5941214500 $8.80 5941214600 $8.80 5941214700 $8.80 5941214800 $8.80 5941214900 $8.80 5941215000 $8.80 5941215100 $8.80 5941215200 $8.80 5941215300 $8.80 5941215400 $8.80 5941215500 $8.80 5941215600 $8.80 5941215700 $8.80 5941215800 $8.80 5941215900 $8.80 5941216000 $8.80 5941216100 $8.80 Page 85 of 189 City of Chula Vista Engineer's ReportPage 300 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5941216200 $8.80 5941216300 $8.80 5941216400 $8.80 5941216500 $8.80 5941216600 $8.80 5941216700 $8.80 5941216800 $8.80 5941216900 $8.80 5941217000 $8.80 5941217100 $8.80 5941217200 $8.80 5941217300 $8.80 5941217400 $8.80 5941217500 $8.80 5941217600 $8.80 5941217700 $8.80 5941218200 $8.80 5941218300 $8.80 5941218400 $8.80 5941220100 $8.80 5941220200 $8.80 5941220300 $8.80 5941220400 $8.80 5941220500 $8.80 5941220600 $8.80 5941220700 $8.80 5941220800 $8.80 5941220900 $8.80 5941221000 $8.80 5941221100 $8.80 5941221200 $8.80 5941221300 $8.80 5941221400 $8.80 5941221500 $8.80 5941221600 $8.80 5941221700 $8.80 5941221800 $8.80 5941221900 $8.80 5941222000 $8.80 5941222100 $8.80 5941222200 $8.80 5941222300 $8.80 5941222400 $8.80 5941222500 $8.80 5941222600 $8.80 5941222700 $8.80 5941222800 $8.80 5941222900 $8.80 5941223000 $8.80 5941223100 $8.80 5941223200 $8.80 5941223300 $8.80 5941223400 $8.80 5941223500 $8.80 5941223600 $8.80 5941223700 $8.80 5941223800 $8.80 5941223900 $8.80 5941224000 $8.80 5941224100 $8.80 5941224200 $8.80 5941224300 $8.80 5941224400 $8.80 5941224500 $8.80 5941224600 $8.80 5941224700 $8.80 5941224800 $8.80 5941224900 $8.80 5941225000 $8.80 5941225100 $8.80 5941225200 $8.80 5941225300 $8.80 5941225400 $8.80 5941225500 $8.80 5941225600 $8.80 5941225700 $8.80 5941225800 $8.80 5941225900 $8.80 5941226000 $8.80 5941226100 $8.80 5941226200 $8.80 5941226300 $8.80 5941226400 $8.80 5941226500 $8.80 5941226600 $8.80 5941226700 $8.80 5941226800 $8.80 5944300100 $8.80 5944300200 $8.80 5944300300 $8.80 5944300400 $8.80 5944300500 $8.80 5944300600 $8.80 5944300700 $8.80 5944300800 $8.80 5944300900 $8.80 5944301000 $8.80 5944301100 $8.80 5944301200 $8.80 5944301300 $8.80 5944301400 $8.80 5944301500 $8.80 5944301600 $8.80 5944301700 $8.80 5944301800 $8.80 5944301900 $8.80 5944302000 $8.80 5944302100 $8.80 5944302200 $8.80 5944302300 $8.80 5944302400 $8.80 5944302500 $8.80 5944302600 $8.80 5944302700 $8.80 5944302800 $8.80 5944302900 $8.80 5944303000 $8.80 5944303100 $8.80 5944303200 $8.80 5944303300 $8.80 5944303400 $8.80 5944303500 $8.80 5944303600 $8.80 5944303700 $8.80 5944303800 $8.80 5944303900 $8.80 5944304000 $8.80 5944304100 $8.80 5944304200 $8.80 5944304300 $8.80 5944304400 $8.80 5944304500 $8.80 5944304600 $8.80 5944304700 $8.80 5944304800 $8.80 5944304900 $8.80 5944305000 $8.80 5944305100 $8.80 5944305200 $8.80 5944305300 $8.80 5944305400 $8.80 Page 86 of 189 City of Chula Vista Engineer's ReportPage 301 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944305500 $8.80 5944305600 $8.80 5944305700 $8.80 5944305800 $8.80 5944305900 $8.80 5944306000 $8.80 5944306100 $8.80 5944306200 $8.80 5944306300 $8.80 5944310100 $8.80 5944310200 $8.80 5944310300 $8.80 5944310400 $8.80 5944310500 $8.80 5944310600 $8.80 5944310700 $8.80 5944310800 $8.80 5944310900 $8.80 5944311000 $8.80 5944311100 $8.80 5944311200 $8.80 5944311300 $8.80 5944311400 $8.80 5944311500 $8.80 5944311600 $8.80 5944311700 $8.80 5944311800 $8.80 5944311900 $8.80 5944312000 $8.80 5944312100 $8.80 5944312200 $8.80 5944312300 $8.80 5944312400 $8.80 5944312500 $8.80 5944312600 $8.80 5944312700 $8.80 5944312800 $8.80 5944312900 $8.80 5944313000 $8.80 5944313100 $8.80 5944313200 $8.80 5944313300 $8.80 5944313400 $8.80 5944313500 $8.80 5944313600 $8.80 5944313700 $8.80 5944313800 $8.80 5944313900 $8.80 5944314000 $8.80 5944314100 $8.80 5944314200 $8.80 5944314300 $8.80 5944314400 $8.80 5944314500 $8.80 5944314600 $8.80 5944314700 $8.80 5944314800 $8.80 5944320200 $8.80 5944320300 $8.80 5944320400 $8.80 5944320500 $8.80 5944320600 $8.80 5944320700 $8.80 5944320800 $8.80 5944320900 $8.80 5944321000 $8.80 5944321100 $8.80 5944321200 $8.80 5944321300 $8.80 5944321400 $8.80 5944321500 $8.80 5944321600 $8.80 5944321700 $8.80 5944321800 $8.80 5944321900 $8.80 5944322000 $8.80 5944322100 $8.80 5944322200 $8.80 5944322300 $8.80 5944322400 $8.80 5944322500 $8.80 5944322600 $8.80 5944322700 $8.80 5944322800 $8.80 5944322900 $8.80 5944323000 $8.80 5944323100 $8.80 5944323200 $8.80 5944323300 $8.80 5944323400 $8.80 5944323500 $8.80 5944323600 $8.80 5944323700 $8.80 5944323800 $8.80 5944323900 $8.80 5944324000 $8.80 5944324100 $8.80 5944324200 $8.80 5944324300 $8.80 5944324400 $8.80 5944324500 $8.80 5944324600 $8.80 5944324700 $8.80 5944324800 $8.80 5944324900 $8.80 5944325000 $8.80 5944325100 $8.80 5944325200 $8.80 5944325300 $8.80 5944325400 $8.80 5944325500 $8.80 5944325600 $8.80 5944325700 $8.80 5944325800 $8.80 5944325900 $8.80 5944326000 $8.80 5944326100 $8.80 5944326200 $8.80 5944326300 $8.80 5944326400 $8.80 5944326500 $8.80 5944326600 $8.80 5944326700 $8.80 5944326800 $8.80 5944326900 $8.80 5944327000 $8.80 5944327100 $8.80 5944327200 $8.80 5944327300 $8.80 5944327400 $8.80 5944327500 $8.80 5944327600 $8.80 5944327700 $8.80 5944327800 $8.80 5944327900 $8.80 5944328000 $8.80 5944328100 $8.80 5944328200 $8.80 5944328300 $8.80 5944328400 $8.80 5944328500 $8.80 Page 87 of 189 City of Chula Vista Engineer's ReportPage 302 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944328600 $8.80 5944328700 $8.80 5944330100 $8.80 5944330200 $8.80 5944330300 $8.80 5944330400 $8.80 5944330500 $8.80 5944330600 $8.80 5944330700 $8.80 5944330800 $8.80 5944330900 $8.80 5944331000 $8.80 5944331100 $8.80 5944331200 $8.80 5944331300 $8.80 5944331400 $8.80 5944331500 $8.80 5944331600 $8.80 5944331700 $8.80 5944331800 $8.80 5944331900 $8.80 5944332000 $8.80 5944332100 $8.80 5944332200 $8.80 5944332300 $8.80 5944332400 $8.80 5944332500 $8.80 5944332600 $8.80 5944332700 $8.80 5944332800 $8.80 5944332900 $8.80 5944333000 $8.80 5944333100 $8.80 5944333300 $8.80 5944333400 $8.80 5944333500 $8.80 5944333600 $8.80 5944333700 $8.80 5944333800 $8.80 5944333900 $8.80 5944334000 $8.80 5944334100 $8.80 5944334200 $8.80 5944334300 $8.80 5944334400 $8.80 5944334500 $8.80 5944334600 $8.80 5944334700 $8.80 5944334800 $8.80 5944334900 $8.80 5944335000 $8.80 5944335100 $8.80 5944335200 $8.80 5944335300 $8.80 5944335400 $8.80 5944335500 $8.80 5944335600 $8.80 5944335700 $8.80 5944335800 $8.80 5944335900 $8.80 5944336000 $8.80 5944336100 $8.80 5944336200 $8.80 5944336300 $8.80 5944336400 $8.80 5944336500 $8.80 5944336600 $8.80 5944336700 $8.80 5944336800 $8.80 5944336900 $8.80 5944337000 $8.80 5944337100 $8.80 5944337200 $8.80 5944337300 $8.80 5944337400 $8.80 5944337800 $8.80 6400210100 $8.80 6400210200 $8.80 6400210300 $8.80 6400210400 $8.80 6400210500 $8.80 6400210600 $8.80 6400210700 $8.80 6400210800 $8.80 6400211000 $8.80 6400211100 $8.80 6400211200 $8.80 6400211300 $8.80 6400211700 $8.80 6400211800 $8.80 6400211900 $8.80 6400212000 $8.80 6400212100 $8.80 6400212200 $8.80 6400212300 $8.80 6400212400 $8.80 6400212500 $8.80 6400212600 $8.80 6400212700 $8.80 6400212800 $8.80 6400212900 $8.80 6400213000 $8.80 6400213100 $8.80 6400213200 $8.80 6400213300 $8.80 6400213400 $8.80 6400213500 $8.80 6400213600 $8.80 6400213700 $8.80 6400213800 $8.80 6400213900 $8.80 6400214000 $8.80 6400214100 $8.80 6400214200 $8.80 6400214300 $8.80 6400214400 $8.80 6400214500 $8.80 6400214600 $8.80 6400214700 $8.80 6400214800 $8.80 6400214900 $8.80 6400215000 $8.80 6400215100 $8.80 6400215200 $8.80 6400215300 $8.80 6400215400 $8.80 6400215500 $8.80 6400215600 $8.80 6400215700 $8.80 6400215800 $8.80 6400215900 $8.80 6400216000 $8.80 6400216100 $8.80 6400216200 $8.80 6400220100 $8.80 6400220200 $8.80 6400220300 $8.80 6400220400 $8.80 6400220500 $8.80 6400220600 $8.80 6400220700 $8.80 Page 88 of 189 City of Chula Vista Engineer's ReportPage 303 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400220800 $8.80 6400220900 $8.80 6400221000 $8.80 6400221100 $8.80 6400221200 $8.80 6400221300 $8.80 6400221400 $8.80 6400221500 $8.80 6400221600 $8.80 6400221700 $8.80 6400221800 $8.80 6400221900 $8.80 6400222000 $8.80 6400222100 $8.80 6400222200 $8.80 6400222300 $8.80 6400222400 $8.80 6400222500 $8.80 6400222600 $8.80 6400222700 $8.80 6400222800 $8.80 6400222900 $8.80 6400223000 $8.80 6400223100 $8.80 6400223200 $8.80 6400223300 $8.80 6400223400 $8.80 6400223500 $8.80 6400223600 $8.80 6400223700 $8.80 6400223800 $8.80 6400223900 $8.80 6400224000 $8.80 6400224100 $8.80 6400224200 $8.80 6400224300 $8.80 6400224400 $8.80 6400224500 $8.80 6400224600 $8.80 6400224700 $8.80 6400224800 $8.80 6400224900 $8.80 6400225000 $8.80 6400225100 $8.80 6400225200 $8.80 6400225300 $8.80 6400225400 $8.80 6400225500 $8.80 6400225600 $8.80 6400225700 $8.80 6400225800 $8.80 6400225900 $8.80 6400226000 $8.80 6400230100 $8.80 6400230200 $8.80 6400230300 $8.80 6400230400 $8.80 6400230500 $8.80 6400230600 $8.80 6400230700 $8.80 6400230800 $8.80 6400230900 $8.80 6400231000 $8.80 6400231100 $8.80 6400231200 $8.80 6400231300 $8.80 6400231400 $8.80 6400231500 $8.80 6400231600 $8.80 6400231700 $8.80 6400231800 $8.80 6400231900 $8.80 6400232000 $8.80 6400232100 $8.80 6400232200 $8.80 6400232300 $8.80 6400232400 $8.80 6400232500 $8.80 6400232600 $8.80 6400232700 $8.80 6400232800 $8.80 6400232900 $8.80 6400233000 $8.80 6400233100 $8.80 6400233200 $8.80 6400233300 $8.80 6400233400 $8.80 6400233500 $8.80 6400233600 $8.80 6400233700 $8.80 6400233800 $8.80 6400233900 $8.80 6400234000 $8.80 6400234100 $8.80 6400234200 $8.80 6400234300 $8.80 6400234400 $8.80 6400234500 $8.80 6400234600 $8.80 6400234700 $8.80 6400310100 $8.80 6400310200 $8.80 6400310300 $8.80 6400310400 $8.80 6400310500 $8.80 6400310600 $8.80 6400310700 $8.80 6400310800 $8.80 6400310900 $8.80 6400311000 $8.80 6400311100 $8.80 6400311200 $8.80 6400311300 $8.80 6400311400 $8.80 6400311500 $8.80 6400311600 $8.80 6400311700 $8.80 6400311800 $8.80 6400311900 $8.80 6400312000 $8.80 6400312100 $8.80 6400312200 $8.80 6400312300 $8.80 6400312400 $8.80 6400312500 $8.80 6400312600 $8.80 6400312700 $8.80 6400312800 $8.80 6400312900 $8.80 6400313000 $8.80 6400313100 $8.80 6400313200 $8.80 6400313300 $8.80 6400313400 $8.80 6400313500 $8.80 6400313600 $8.80 6400313700 $8.80 6400313800 $8.80 6400313900 $8.80 6400314000 $8.80 6400314100 $8.80 Page 89 of 189 City of Chula Vista Engineer's ReportPage 304 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400314200 $8.80 6400314300 $8.80 6400314400 $8.80 6400314500 $8.80 6400314600 $8.80 6400314700 $8.80 6400314800 $8.80 6400314900 $8.80 6400315000 $8.80 6400315100 $8.80 6400315200 $8.80 6400315300 $8.80 6400315400 $8.80 6400315500 $8.80 6400320100 $8.80 6400320200 $8.80 6400320300 $8.80 6400320400 $8.80 6400320500 $8.80 6400320600 $8.80 6400320700 $8.80 6400320800 $8.80 6400320900 $8.80 6400321000 $8.80 6400321100 $8.80 6400321200 $8.80 6400321300 $8.80 6400321400 $8.80 6400321500 $8.80 6400321800 $8.80 6400321900 $8.80 6400322000 $8.80 6400322100 $8.80 6400322200 $8.80 6400322300 $8.80 6400322400 $8.80 6400322500 $8.80 6400322600 $8.80 6400322700 $8.80 6400322800 $8.80 6400322900 $8.80 6400323000 $8.80 6400323100 $8.80 6400323200 $8.80 6400323300 $8.80 6400323400 $8.80 6400323500 $8.80 6400323600 $8.80 6400323700 $8.80 6400323800 $8.80 6400323900 $8.80 6400324000 $8.80 6400324100 $8.80 6400324200 $8.80 6400324300 $8.80 6400324400 $8.80 6400324500 $8.80 6400324600 $8.80 6400324700 $8.80 6400324800 $8.80 6400324900 $8.80 6400325000 $8.80 6400325100 $8.80 6400325200 $8.80 6400325300 $8.80 6400325400 $8.80 6400325500 $8.80 6400325600 $8.80 6400325700 $8.80 6400325800 $8.80 6400325900 $8.80 6400326300 $8.80 6400326400 $8.80 6400330100 $8.80 6400330200 $8.80 6400330300 $8.80 6400330400 $8.80 6400330500 $8.80 6400330600 $8.80 6400330700 $8.80 6400330800 $8.80 6400330900 $8.80 6400331000 $8.80 6400331100 $8.80 6400331200 $8.80 6400331300 $8.80 6400331400 $8.80 6400331500 $8.80 6400331600 $8.80 6400331700 $8.80 6400331800 $8.80 6400331900 $8.80 6400332000 $8.80 6400332100 $8.80 6400332200 $8.80 6400332300 $8.80 6400332400 $8.80 6400332500 $8.80 6400332600 $8.80 6400332700 $8.80 6400332800 $8.80 6400332900 $8.80 6400333000 $8.80 6400333100 $8.80 6400333200 $8.80 6400333300 $8.80 6400333400 $8.80 6400333500 $8.80 6400333600 $8.80 6400333700 $8.80 6400333800 $8.80 6400333900 $8.80 6400334000 $8.80 6400334100 $8.80 6400334200 $8.80 6400334300 $8.80 6400334400 $8.80 6400334500 $8.80 6400334600 $8.80 6400334700 $8.80 6400334800 $8.80 6400334900 $8.80 6400335000 $8.80 6400335100 $8.80 6400335200 $8.80 6400335300 $8.80 6400335400 $8.80 6400335500 $8.80 6400335600 $8.80 6400335700 $8.80 6400335800 $8.80 6400335900 $8.80 6400336000 $8.80 6400336100 $8.80 6400902300 $282.16 6402910400 $386.20 6402910500 $285.68 6402910600 $481.44 6402911300 $3,560.54 6402921900 $481.44 6402922000 $1,137.46 Page 90 of 189 City of Chula Vista Engineer's ReportPage 305 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402923600 $3,026.20 6402923900 $320.06 6402924000 $253.94 6402924400 $100.52 6402924600 $1,002.56 6402924700 $264.52 6402924800 $264.52 6402925000 $3,732.48 6402925200 $489.36 6402925300 $195.74 6402930300 $666.60 6402930400 $806.80 6402930600 $272.46 6402931200 $293.62 6402931500 $367.68 6402931600 $232.78 6402931700 $201.04 6402932300 $952.30 6402932600 $335.94 6402932700 $690.40 6402932800 $973.46 6402933100 $790.92 6402933201 $19.82 6402933202 $19.82 6402933203 $19.82 6402933204 $19.82 6402933205 $19.82 6402933206 $19.82 6402933207 $19.82 6402933208 $19.82 6402933209 $19.82 6402933210 $19.82 6402933211 $19.82 6402933212 $19.82 6402933213 $19.82 6402933214 $19.82 6402933215 $19.82 6402933216 $19.82 6402933217 $19.82 6402933218 $19.82 6403100100 $8.80 6403100200 $8.80 6403100300 $8.80 6403100400 $8.80 6403100500 $8.80 6403100600 $8.80 6403100700 $8.80 6403100800 $8.80 6403100900 $8.80 6403101000 $8.80 6403101100 $8.80 6403101200 $8.80 6403101300 $8.80 6403101400 $8.80 6403101500 $8.80 6403101600 $8.80 6403101700 $8.80 6403101800 $8.80 6403101900 $8.80 6403102000 $8.80 6403102100 $8.80 6403102200 $8.80 6403102300 $8.80 6403102400 $8.80 6403102500 $8.80 6403102600 $8.80 6403102700 $8.80 6403102800 $8.80 6403102900 $8.80 6403103000 $8.80 6403103100 $8.80 6403103200 $8.80 6403103300 $8.80 6403103400 $8.80 6403103500 $8.80 6403103600 $8.80 6403103700 $8.80 6403103800 $8.80 6403103900 $8.80 6403104000 $8.80 6403104100 $8.80 6403104200 $8.80 6403104300 $8.80 6403104400 $8.80 6403104500 $8.80 6403104600 $8.80 6403104700 $8.80 6403104800 $8.80 6403104900 $8.80 6403105000 $8.80 6403105100 $8.80 6403105200 $8.80 6403105300 $8.80 6403105400 $8.80 6403105500 $8.80 6403105600 $8.80 6403105700 $8.80 6403105800 $8.80 6403105900 $8.80 6403106000 $8.80 6403106100 $8.80 6403106200 $8.80 6403106300 $8.80 6403106400 $8.80 6403106500 $8.80 6403106600 $8.80 6403106700 $8.80 6403106800 $8.80 6403106900 $8.80 6403107000 $8.80 6403107100 $8.80 6403107200 $8.80 6403107300 $8.80 6403107400 $8.80 6403107500 $8.80 6403107600 $8.80 6403107700 $8.80 6403107800 $8.80 6403107900 $8.80 6403108000 $8.80 6403108100 $8.80 6403108200 $8.80 6403108300 $8.80 6403108400 $8.80 6403108500 $8.80 6403108600 $8.80 6403108700 $8.80 6403108800 $8.80 6403108900 $8.80 6403109000 $8.80 6403109100 $8.80 6403110100 $8.80 6403110200 $8.80 6403110300 $8.80 6403110400 $8.80 6403110500 $8.80 6403110600 $8.80 6403110700 $8.80 6403110800 $8.80 6403110900 $8.80 6403111000 $8.80 Page 91 of 189 City of Chula Vista Engineer's ReportPage 306 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403111100 $8.80 6403111200 $8.80 6403111300 $8.80 6403111400 $8.80 6403111500 $8.80 6403111600 $8.80 6403111700 $8.80 6403111800 $8.80 6403111900 $8.80 6403112000 $8.80 6403112100 $8.80 6403112200 $8.80 6403112300 $8.80 6403112400 $8.80 6403112500 $8.80 6403112600 $8.80 6403112700 $8.80 6403112800 $8.80 6403112900 $8.80 6403113000 $8.80 6403113100 $8.80 6403113200 $8.80 6403113300 $8.80 6403113400 $8.80 6403113500 $8.80 6403113600 $8.80 6403113700 $8.80 6403113800 $8.80 6403113900 $8.80 6403114000 $8.80 6403114100 $8.80 6403114200 $8.80 6403114300 $8.80 6403114400 $8.80 6403114500 $8.80 6403114600 $8.80 6403114700 $8.80 6403114800 $8.80 6403114900 $8.80 6403115000 $8.80 6403115100 $8.80 6403115200 $8.80 6403115300 $8.80 6403115400 $8.80 6403115500 $8.80 6403115600 $8.80 6403115700 $8.80 6403115800 $8.80 6403115900 $8.80 6403116000 $8.80 6403116100 $8.80 6403116200 $8.80 6403116300 $8.80 6403116400 $8.80 6403116500 $8.80 6403116600 $8.80 6403116700 $8.80 6403116800 $8.80 6403116900 $8.80 6403117000 $8.80 6403117100 $8.80 6403117200 $8.80 6403117300 $8.80 6403117400 $8.80 6403117500 $8.80 6403117600 $8.80 6403210100 $8.80 6403210200 $8.80 6403210300 $8.80 6403210400 $8.80 6403210500 $8.80 6403210600 $8.80 6403210700 $8.80 6403210800 $8.80 6403210900 $8.80 6403211000 $8.80 6403211100 $8.80 6403211200 $8.80 6403211300 $8.80 6403211400 $8.80 6403211500 $8.80 6403211600 $8.80 6403211700 $8.80 6403211800 $8.80 6403211900 $8.80 6403212000 $8.80 6403212100 $8.80 6403212200 $8.80 6403212300 $8.80 6403212400 $8.80 6403220100 $8.80 6403220200 $8.80 6403220300 $8.80 6403220400 $8.80 6403220500 $8.80 6403220600 $8.80 6403220700 $8.80 6403220800 $8.80 6403220900 $8.80 6403221000 $8.80 6403221100 $8.80 6403221200 $8.80 6403221300 $8.80 6403221400 $8.80 6403221500 $8.80 6403221600 $8.80 6403221700 $8.80 6403221800 $8.80 6403221900 $8.80 6403222000 $8.80 6403222100 $8.80 6403222200 $8.80 6403222300 $8.80 6403222400 $8.80 6403222500 $8.80 6403222600 $8.80 6403222700 $8.80 6403222800 $8.80 6403222900 $8.80 6403223000 $8.80 6403223100 $8.80 6403223200 $8.80 6403223300 $8.80 6403223400 $8.80 6403223500 $8.80 6403223600 $8.80 6403223700 $8.80 6403223800 $8.80 6403223900 $8.80 6403224000 $8.80 6403224100 $8.80 6403224200 $8.80 6403230100 $8.80 6403230200 $8.80 6403230300 $8.80 6403230400 $8.80 6403230500 $8.80 6403230600 $8.80 6403230700 $8.80 6403230800 $8.80 6403230900 $8.80 Page 92 of 189 City of Chula Vista Engineer's ReportPage 307 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403231000 $8.80 6403231100 $8.80 6403231200 $8.80 6403231300 $8.80 6403231400 $8.80 6403231500 $8.80 6403231600 $8.80 6403231700 $8.80 6403231800 $8.80 6403231900 $8.80 6403232000 $8.80 6403232100 $8.80 6403232200 $8.80 6403232300 $8.80 6403232400 $8.80 6403232500 $8.80 6403232600 $8.80 6403232700 $8.80 6403232800 $8.80 6403232900 $8.80 6403233000 $8.80 6403233100 $8.80 6403233200 $8.80 6403233300 $8.80 6403233400 $8.80 6403233500 $8.80 6403233600 $8.80 6403233700 $8.80 6403233800 $8.80 6403233900 $8.80 6403234000 $8.80 6403300101 $7.04 6403300102 $7.04 6403300103 $7.04 6403300104 $7.04 6403300105 $7.04 6403300106 $7.04 6403300107 $7.04 6403300108 $7.04 6403300109 $7.04 6403300110 $7.04 6403300111 $7.04 6403300201 $7.04 6403300202 $7.04 6403300203 $7.04 6403300204 $7.04 6403300205 $7.04 6403300206 $7.04 6403300207 $7.04 6403300301 $7.04 6403300302 $7.04 6403300303 $7.04 6403300304 $7.04 6403300305 $7.04 6403300306 $7.04 6403300307 $7.04 6403300308 $7.04 6403300401 $7.04 6403300402 $7.04 6403300403 $7.04 6403300404 $7.04 6403300405 $7.04 6403300406 $7.04 6403300407 $7.04 6403300408 $7.04 6403300501 $7.04 6403300502 $7.04 6403300503 $7.04 6403300504 $7.04 6403300505 $7.04 6403300506 $7.04 6403300601 $7.04 6403300602 $7.04 6403300603 $7.04 6403300604 $7.04 6403300605 $7.04 6403300606 $7.04 6403300701 $7.04 6403300702 $7.04 6403300703 $7.04 6403300704 $7.04 6403300705 $7.04 6403300706 $7.04 6403300707 $7.04 6403301101 $7.04 6403301102 $7.04 6403301103 $7.04 6403301104 $7.04 6403301105 $7.04 6403301106 $7.04 6403301107 $7.04 6403301201 $7.04 6403301202 $7.04 6403301203 $7.04 6403301204 $7.04 6403301205 $7.04 6403301206 $7.04 6403301207 $7.04 6403301301 $7.04 6403301302 $7.04 6403301303 $7.04 6403301304 $7.04 6403301305 $7.04 6403301306 $7.04 6403301307 $7.04 6403301401 $7.04 6403301402 $7.04 6403301403 $7.04 6403301404 $7.04 6403301405 $7.04 6403301406 $7.04 6403301407 $7.04 6403301408 $7.04 6403301409 $7.04 6403301501 $7.04 6403301502 $7.04 6403301503 $7.04 6403301504 $7.04 6403301505 $7.04 6403301506 $7.04 6403301507 $7.04 6403301601 $7.04 6403301602 $7.04 6403301603 $7.04 6403301604 $7.04 6403301605 $7.04 6403301606 $7.04 6403301607 $7.04 6403301608 $7.04 6403301701 $7.04 6403301702 $7.04 6403301703 $7.04 6403301704 $7.04 6403301705 $7.04 6403301706 $7.04 6403301707 $7.04 6403301801 $7.04 6403301802 $7.04 6403301803 $7.04 6403301804 $7.04 6403301805 $7.04 Page 93 of 189 City of Chula Vista Engineer's ReportPage 308 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403301806 $7.04 6403301807 $7.04 6403301808 $7.04 6403301901 $7.04 6403301902 $7.04 6403301903 $7.04 6403301904 $7.04 6403301905 $7.04 6403301906 $7.04 6403301907 $7.04 6403301908 $7.04 6403302001 $7.04 6403302002 $7.04 6403302003 $7.04 6403302004 $7.04 6403302005 $7.04 6403302101 $7.04 6403302102 $7.04 6403302103 $7.04 6403302104 $7.04 6403302105 $7.04 6403302106 $7.04 6403302107 $7.04 6403302108 $7.04 6403302201 $7.04 6403302202 $7.04 6403302203 $7.04 6403302204 $7.04 6403302205 $7.04 6403302206 $7.04 6403302207 $7.04 6403302301 $7.04 6403302302 $7.04 6403302303 $7.04 6403302304 $7.04 6403302305 $7.04 6403302306 $7.04 6403302401 $7.04 6403302402 $7.04 6403302403 $7.04 6403302404 $7.04 6403302405 $7.04 6403302406 $7.04 6403302407 $7.04 6403302501 $7.04 6403302502 $7.04 6403302503 $7.04 6403302504 $7.04 6403302505 $7.04 6403302506 $7.04 6403302507 $7.04 6403302508 $7.04 6403302601 $7.04 6403302602 $7.04 6403302603 $7.04 6403302604 $7.04 6403302605 $7.04 6403302606 $7.04 6403302607 $7.04 6403302608 $7.04 6403302701 $7.04 6403302702 $7.04 6403302703 $7.04 6403302704 $7.04 6403302705 $7.04 6403302706 $7.04 6403302707 $7.04 6403304201 $7.04 6403304202 $7.04 6403304203 $7.04 6403304204 $7.04 6403304205 $7.04 6403304206 $7.04 6403304207 $7.04 6403304301 $7.04 6403304302 $7.04 6403304303 $7.04 6403304304 $7.04 6403304305 $7.04 6403304306 $7.04 6403304307 $7.04 6403304308 $7.04 6403304309 $7.04 6403304401 $7.04 6403304402 $7.04 6403304403 $7.04 6403304404 $7.04 6403304405 $7.04 6403304406 $7.04 6403304407 $7.04 6403400100 $8.80 6403400200 $8.80 6403400300 $8.80 6403400400 $8.80 6403400500 $8.80 6403400600 $8.80 6403400700 $8.80 6403400800 $8.80 6403400900 $8.80 6403401000 $8.80 6403401100 $8.80 6403401200 $8.80 6403401300 $8.80 6403401400 $8.80 6403401500 $8.80 6403401600 $8.80 6403401700 $8.80 6403401800 $8.80 6403401900 $8.80 6403402000 $8.80 6403402100 $8.80 6403402200 $8.80 6403402300 $8.80 6403402400 $8.80 6403402500 $8.80 6403402600 $8.80 6403402700 $8.80 6403402800 $8.80 6403402900 $8.80 6403403000 $8.80 6403403100 $8.80 6403403200 $8.80 6403403300 $8.80 6403403400 $8.80 6403403500 $8.80 6403403600 $8.80 6403403700 $8.80 6403403800 $8.80 6403403900 $8.80 6403404000 $8.80 6403404100 $8.80 6403404200 $8.80 6403404300 $8.80 6403404400 $8.80 6403404500 $8.80 6403404600 $8.80 6403404700 $8.80 6403404800 $8.80 6403404900 $8.80 6403405000 $8.80 6403405100 $8.80 Page 94 of 189 City of Chula Vista Engineer's ReportPage 309 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403405200 $8.80 6403405300 $8.80 6403405400 $8.80 6403405500 $8.80 6403405600 $8.80 6403405700 $8.80 6403405800 $8.80 6403405900 $8.80 6403406000 $8.80 6403406100 $8.80 6403406200 $8.80 6403406300 $8.80 6403406400 $8.80 6403406500 $8.80 6403406600 $8.80 6403406700 $8.80 6403406800 $8.80 6403406900 $8.80 6403407000 $8.80 6403407100 $8.80 6403407200 $8.80 6403407300 $8.80 6403407400 $8.80 6403407500 $8.80 6403407600 $8.80 6403407700 $8.80 6403407800 $8.80 6403407900 $8.80 6403408000 $8.80 6403408100 $8.80 6403408200 $8.80 6403408300 $8.80 6403408400 $8.80 6403408500 $8.80 6403500100 $8.80 6403500200 $8.80 6403500300 $8.80 6403500400 $8.80 6403500500 $8.80 6403500600 $8.80 6403500700 $8.80 6403500800 $8.80 6403500900 $8.80 6403501000 $8.80 6403501100 $8.80 6403501200 $8.80 6403501300 $8.80 6403501400 $8.80 6403501500 $8.80 6403501600 $8.80 6403501700 $8.80 6403501800 $8.80 6403501900 $8.80 6403502000 $8.80 6403502100 $8.80 6403502200 $8.80 6403502300 $8.80 6403502400 $8.80 6403502500 $8.80 6403502600 $8.80 6403502700 $8.80 6403502800 $8.80 6403502900 $8.80 6403503000 $8.80 6403503100 $8.80 6403503200 $8.80 6403503300 $8.80 6403503400 $8.80 6403503500 $8.80 6403503600 $8.80 6403503700 $8.80 6403503800 $8.80 6403503900 $8.80 6403504000 $8.80 6403504100 $8.80 6403504200 $8.80 6403504300 $8.80 6403504400 $8.80 6403504500 $8.80 6403504600 $8.80 6403504700 $8.80 6403504800 $8.80 6403504900 $8.80 6403505000 $8.80 6403505100 $8.80 6403505200 $8.80 6403505300 $8.80 6403505400 $8.80 6403505500 $8.80 6403505600 $8.80 6403505700 $8.80 6403505800 $8.80 6403505900 $8.80 6403506000 $8.80 6403506100 $8.80 6403506200 $8.80 6403506300 $8.80 6403506400 $8.80 6403506500 $8.80 6403506600 $8.80 6403506700 $8.80 6403506800 $8.80 6403506900 $8.80 6403507000 $8.80 6403507100 $8.80 6403507200 $8.80 6403510100 $8.80 6403510200 $8.80 6403510300 $8.80 6403510400 $8.80 6403510500 $8.80 6403510600 $8.80 6403510700 $8.80 6403510800 $8.80 6403510900 $8.80 6403511000 $8.80 6403511100 $8.80 6403511200 $8.80 6403511300 $8.80 6403511400 $8.80 6403511500 $8.80 6403511600 $8.80 6403511700 $8.80 6403511800 $8.80 6403511900 $8.80 6403512000 $8.80 6403512100 $8.80 6403512200 $8.80 6403512300 $8.80 6403512400 $8.80 6403512500 $8.80 6403512600 $8.80 6403512700 $8.80 6403512800 $8.80 6403512900 $8.80 6403513000 $8.80 6403513100 $8.80 6403513200 $8.80 6403513300 $8.80 6403513400 $8.80 6403513500 $8.80 Page 95 of 189 City of Chula Vista Engineer's ReportPage 310 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403513600 $8.80 6403513700 $8.80 6403513800 $8.80 6403513900 $8.80 6403514000 $8.80 6403514100 $8.80 6403514200 $8.80 6403514300 $8.80 6403514400 $8.80 6403514500 $8.80 6403514600 $8.80 6403514700 $8.80 6403514800 $8.80 6403514900 $8.80 6403515000 $8.80 6403515100 $8.80 6403515200 $8.80 6403515300 $8.80 6403515400 $8.80 6403515500 $8.80 6403515600 $8.80 6403515700 $8.80 6403515800 $8.80 6403515900 $8.80 6403516000 $8.80 6403516100 $8.80 6403516200 $8.80 6403516300 $8.80 6403516400 $8.80 6403516500 $8.80 6403516600 $8.80 6403516700 $8.80 6403516800 $8.80 6403516900 $8.80 6403517000 $8.80 6403517100 $8.80 6403517200 $8.80 6403517300 $8.80 6403517400 $8.80 6403517500 $8.80 6403517600 $8.80 6403517700 $8.80 6403517800 $8.80 6403517900 $8.80 6403518000 $8.80 6403518100 $8.80 6403518200 $8.80 6403518300 $8.80 6403518400 $8.80 6403600100 $8.80 6403600200 $8.80 6403600300 $8.80 6403600400 $8.80 6403600500 $8.80 6403600600 $8.80 6403600700 $8.80 6403600800 $8.80 6403600900 $8.80 6403601000 $8.80 6403601100 $8.80 6403601200 $8.80 6403601300 $8.80 6403601400 $8.80 6403601500 $8.80 6403601600 $8.80 6403601700 $8.80 6403601800 $8.80 6403601900 $8.80 6403602000 $8.80 6403602100 $8.80 6403700100 $8.80 6403700200 $8.80 6403700300 $8.80 6403700400 $8.80 6403700500 $8.80 6403700600 $8.80 6403700700 $8.80 6403700800 $8.80 6403700900 $8.80 6403701000 $8.80 6403701100 $15.80 6403800100 $8.80 6403800200 $8.80 6403800300 $8.80 6403800400 $8.80 6403800500 $8.80 6403800600 $8.80 6403800700 $8.80 6403800800 $8.80 6403800900 $8.80 6403801000 $8.80 6403801100 $8.80 6403801200 $8.80 6403801300 $8.80 6403801400 $8.80 6403801500 $8.80 6403801600 $8.80 6403801700 $8.80 6403801800 $8.80 6403801900 $8.80 6403802000 $8.80 6403802100 $8.80 6403802200 $8.80 6403802300 $8.80 6403802400 $8.80 6403802500 $8.80 6403802600 $8.80 6403802700 $8.80 6403802800 $8.80 6403802900 $8.80 6403803000 $8.80 6403803100 $8.80 6403803200 $8.80 6403803300 $8.80 6403803400 $8.80 6403803500 $8.80 6403803600 $8.80 6403803700 $8.80 6403803800 $8.80 6403803900 $8.80 6403804000 $8.80 6403804100 $8.80 6403804200 $8.80 6403804300 $8.80 6403804400 $8.80 6403804500 $8.80 6403804600 $8.80 6403804700 $8.80 6403804800 $8.80 6403804900 $8.80 6403805000 $8.80 6403805100 $8.80 6403805200 $8.80 6403805300 $8.80 6403805400 $8.80 6403805500 $8.80 6403805600 $8.80 6403805700 $8.80 6403810100 $8.80 6403810200 $8.80 6403810300 $8.80 Page 96 of 189 City of Chula Vista Engineer's ReportPage 311 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403810400 $8.80 6403810500 $8.80 6403810600 $8.80 6403810700 $8.80 6403810800 $8.80 6403810900 $8.80 6403811000 $8.80 6403811100 $8.80 6403811200 $8.80 6403811300 $8.80 6403811400 $8.80 6403811500 $8.80 6403811600 $8.80 6403811700 $8.80 6403811800 $8.80 6403811900 $8.80 6403812000 $8.80 6403812100 $8.80 6403812200 $8.80 6403812300 $8.80 6403812400 $8.80 6403812500 $8.80 6403812600 $8.80 6403812700 $8.80 6403812800 $8.80 6403812900 $8.80 6403813000 $8.80 6403813100 $8.80 6403813200 $8.80 6403813300 $8.80 6403813400 $8.80 6403813900 $8.80 6403814000 $8.80 6403814100 $8.80 6403814200 $8.80 6403814300 $8.80 6403814400 $8.80 6403814500 $8.80 6403814600 $8.80 6403814700 $8.80 6403815100 $8.80 6403815200 $8.80 6403815300 $8.80 6403815400 $8.80 6403815500 $8.80 6403815600 $8.80 6403815700 $8.80 6403815800 $8.80 6403815900 $8.80 6403816000 $8.80 6403816100 $8.80 6403816200 $8.80 6403816300 $8.80 6403816400 $8.80 6403816500 $8.80 6403816600 $8.80 6403816700 $8.80 6403816800 $8.80 6403816900 $8.80 6403817000 $8.80 6403817100 $8.80 6403817200 $8.80 6403817300 $8.80 6403817400 $8.80 6403817500 $8.80 6403817600 $8.80 6403817700 $8.80 6403817800 $8.80 6403817900 $8.80 6403818000 $8.80 6403818100 $8.80 6403818200 $8.80 6403818300 $8.80 6403818400 $8.80 6403818500 $8.80 6403900100 $8.80 6403900200 $8.80 6403900300 $8.80 6403900400 $8.80 6403900500 $8.80 6403900600 $8.80 6403900700 $8.80 6403900800 $8.80 6403900900 $8.80 6403901000 $8.80 6403901100 $8.80 6403901200 $8.80 6403901300 $8.80 6403901400 $8.80 6403901500 $8.80 6403901600 $8.80 6403901700 $8.80 6403901800 $8.80 6403901900 $8.80 6403902000 $8.80 6403910100 $8.80 6403910200 $8.80 6403910300 $8.80 6403910400 $8.80 6403910500 $8.80 6403910600 $8.80 6403910700 $8.80 6403910800 $8.80 6403910900 $8.80 6403911000 $8.80 6403911100 $8.80 6403911200 $8.80 6403911300 $8.80 6403911400 $8.80 6403911500 $8.80 6403911600 $8.80 6403911700 $8.80 6403911800 $8.80 6403911900 $8.80 6403912000 $8.80 6403912100 $8.80 6403912200 $8.80 6403912300 $8.80 6403912400 $8.80 6403912500 $8.80 6403912600 $8.80 6403912700 $8.80 6403912800 $8.80 6403912900 $8.80 6403913000 $8.80 6403913100 $8.80 6403913200 $8.80 6403913300 $8.80 6403913400 $8.80 6403913500 $8.80 6403913600 $8.80 6403913700 $8.80 6403913800 $8.80 6403913900 $8.80 6403914000 $8.80 6403914100 $8.80 6403914200 $8.80 6403920100 $8.80 6403920200 $8.80 6403920300 $8.80 6403920400 $8.80 Page 97 of 189 City of Chula Vista Engineer's ReportPage 312 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403920500 $8.80 6403920600 $8.80 6403920700 $8.80 6403920800 $8.80 6403920900 $8.80 6403921000 $8.80 6403921100 $8.80 6403921200 $8.80 6403921300 $8.80 6403921400 $8.80 6403921500 $8.80 6403921600 $8.80 6403921700 $8.80 6403921800 $8.80 6403921900 $8.80 6403922000 $8.80 6403922100 $8.80 6403922200 $8.80 6403922300 $8.80 6403922400 $8.80 6403922500 $8.80 6403922600 $8.80 6403922700 $8.80 6403922800 $8.80 6403922900 $8.80 6403923000 $8.80 6403923100 $8.80 6403923200 $8.80 6403923300 $8.80 6403923400 $8.80 6403923500 $8.80 6403923600 $8.80 6403923700 $8.80 6403923800 $8.80 6403923900 $8.80 6403924000 $8.80 6403924100 $8.80 6403924200 $8.80 6403924300 $8.80 6403924400 $8.80 6403924500 $8.80 6403924600 $8.80 6403924700 $8.80 6403924800 $8.80 6403924900 $8.80 6403925000 $8.80 6403925100 $8.80 6403925200 $8.80 6403925300 $8.80 6403925400 $8.80 6403925500 $8.80 6403925600 $8.80 6403925700 $8.80 6403925800 $8.80 6403925900 $8.80 6403926000 $8.80 6403926100 $8.80 6403926200 $8.80 6403926300 $8.80 6403926400 $8.80 6403926500 $8.80 6403926600 $8.80 6403926700 $8.80 6403926800 $8.80 6403926900 $8.80 6403927000 $8.80 6403927100 $8.80 6403927200 $8.80 6403927300 $8.80 6403927400 $8.80 6403927500 $8.80 6403927600 $8.80 6403927700 $8.80 6403927800 $8.80 6403927900 $8.80 6403928000 $8.80 6404000100 $7.04 6404000200 $7.04 6404000300 $7.04 6404000400 $7.04 6404000500 $7.04 6404000600 $7.04 6404000700 $7.04 6404000800 $7.04 6404000900 $7.04 6404001000 $7.04 6404001100 $7.04 6404001200 $7.04 6404001300 $7.04 6404001400 $7.04 6404001500 $7.04 6404001600 $7.04 6404001700 $7.04 6404001800 $7.04 6404001900 $7.04 6404002000 $7.04 6404002100 $7.04 6404002200 $7.04 6404002300 $7.04 6404002400 $7.04 6404002500 $7.04 6404002600 $7.04 6404002700 $7.04 6404002800 $7.04 6404002900 $7.04 6404003000 $7.04 6404003100 $7.04 6404003200 $7.04 6404003300 $7.04 6404003400 $7.04 6404003500 $7.04 6404003600 $7.04 6404003700 $7.04 6404003800 $7.04 6404003900 $7.04 6404004000 $7.04 6404004100 $7.04 6404004200 $7.04 6404004300 $7.04 6404004400 $7.04 6404004500 $7.04 6404004600 $7.04 6404004700 $7.04 6404004800 $7.04 6404004900 $7.04 6404005000 $7.04 6404005100 $7.04 6404005200 $7.04 6404005300 $7.04 6404005400 $7.04 6404005500 $7.04 6404005600 $7.04 6404005700 $7.04 6404005800 $7.04 6404005900 $7.04 6404006000 $7.04 6404006100 $7.04 6404006200 $7.04 6404006300 $7.04 6404006400 $7.04 6404006500 $7.04 Page 98 of 189 City of Chula Vista Engineer's ReportPage 313 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404006600 $7.04 6404006700 $7.04 6404006800 $7.04 6404010100 $7.04 6404010200 $7.04 6404010300 $7.04 6404010400 $7.04 6404010500 $7.04 6404010600 $7.04 6404010700 $7.04 6404010800 $7.04 6404010900 $7.04 6404011000 $7.04 6404011100 $7.04 6404011200 $7.04 6404011300 $7.04 6404011400 $7.04 6404011500 $7.04 6404011600 $7.04 6404011700 $7.04 6404011800 $7.04 6404011900 $7.04 6404012000 $7.04 6404012100 $7.04 6404012200 $7.04 6404012300 $7.04 6404012400 $7.04 6404012500 $7.04 6404012600 $7.04 6404012700 $7.04 6404012800 $7.04 6404012900 $7.04 6404013000 $7.04 6404013100 $7.04 6404013200 $7.04 6404013300 $7.04 6404013400 $7.04 6404013500 $7.04 6404013600 $7.04 6404013700 $7.04 6404013800 $7.04 6404013900 $7.04 6404014000 $7.04 6404014100 $7.04 6404014200 $7.04 6404014300 $7.04 6404014400 $7.04 6404014500 $7.04 6404014600 $7.04 6404014700 $7.04 6404014800 $7.04 6404014900 $7.04 6404015000 $7.04 6404015100 $7.04 6404015200 $7.04 6404100100 $8.80 6404100200 $8.80 6404100300 $8.80 6404100400 $8.80 6404100500 $8.80 6404100600 $8.80 6404100700 $8.80 6404100800 $8.80 6404100900 $8.80 6404101000 $8.80 6404101100 $8.80 6404101200 $8.80 6404101300 $8.80 6404101400 $8.80 6404101500 $8.80 6404101600 $8.80 6404101700 $8.80 6404101800 $8.80 6404101900 $8.80 6404102000 $8.80 6404102100 $8.80 6404102200 $8.80 6404102300 $8.80 6404102400 $8.80 6404102500 $8.80 6404102600 $8.80 6404102700 $8.80 6404102800 $8.80 6404102900 $8.80 6404103000 $8.80 6404103100 $8.80 6404103200 $8.80 6404103300 $8.80 6404103400 $8.80 6404103500 $8.80 6404103600 $8.80 6404103700 $8.80 6404103800 $8.80 6404103900 $8.80 6404104000 $8.80 6404104100 $8.80 6404104200 $8.80 6404104300 $8.80 6404104400 $8.80 6404104500 $8.80 6404104600 $8.80 6404104700 $8.80 6404104800 $8.80 6404104900 $8.80 6404105000 $8.80 6404105100 $8.80 6404110100 $8.80 6404110200 $8.80 6404110300 $8.80 6404110400 $8.80 6404110500 $8.80 6404110600 $8.80 6404110700 $8.80 6404110800 $8.80 6404110900 $8.80 6404111000 $8.80 6404111100 $8.80 6404111200 $8.80 6404111300 $8.80 6404111400 $8.80 6404111500 $8.80 6404111600 $8.80 6404111700 $8.80 6404111800 $8.80 6404111900 $8.80 6404112000 $8.80 6404112100 $8.80 6404112200 $8.80 6404112300 $8.80 6404112400 $8.80 6404112500 $8.80 6404112600 $8.80 6404112700 $8.80 6404112800 $8.80 6404112900 $8.80 6404113000 $8.80 6404113100 $8.80 6404113200 $8.80 6404113300 $8.80 6404113400 $8.80 6404113500 $8.80 Page 99 of 189 City of Chula Vista Engineer's ReportPage 314 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404113600 $8.80 6404113700 $8.80 6404113800 $8.80 6404113900 $8.80 6404114000 $8.80 6404114100 $8.80 6404114200 $8.80 6404114300 $8.80 6404114400 $8.80 6404114500 $8.80 6404114600 $8.80 6404114700 $8.80 6404114800 $8.80 6404114900 $8.80 6404115000 $8.80 6404115100 $8.80 6404115200 $8.80 6404115300 $8.80 6404115400 $8.80 6404115500 $8.80 6404115600 $8.80 6404115700 $8.80 6404115800 $8.80 6404115900 $8.80 6404116000 $8.80 6404116100 $8.80 6404116200 $8.80 6404116300 $8.80 6404116400 $8.80 6404116500 $8.80 6404116600 $8.80 6404116700 $8.80 6404116800 $8.80 6404116900 $8.80 6404117000 $8.80 6404117100 $8.80 6404117200 $8.80 6404117300 $8.80 6404117400 $8.80 6404117500 $8.80 6404117600 $8.80 6404117700 $8.80 6404117800 $8.80 6404117900 $8.80 6404118000 $8.80 6404118100 $8.80 6404200100 $8.80 6404200200 $8.80 6404200300 $8.80 6404200400 $8.80 6404200500 $8.80 6404200600 $8.80 6404200700 $8.80 6404200800 $8.80 6404200900 $8.80 6404201000 $8.80 6404201100 $8.80 6404201200 $8.80 6404201300 $8.80 6404201400 $8.80 6404201500 $8.80 6404201600 $8.80 6404201700 $8.80 6404201800 $8.80 6404201900 $8.80 6404202000 $8.80 6404202100 $8.80 6404202200 $8.80 6404202300 $8.80 6404202400 $8.80 6404202500 $8.80 6404202600 $8.80 6404202700 $8.80 6404202800 $8.80 6404202900 $8.80 6404203000 $8.80 6404203100 $8.80 6404203200 $8.80 6404203300 $8.80 6404203400 $8.80 6404203500 $8.80 6404203600 $8.80 6404203700 $8.80 6404203800 $8.80 6404203900 $8.80 6404204000 $8.80 6404204100 $8.80 6404204200 $8.80 6404204300 $8.80 6404204400 $8.80 6404204500 $8.80 6404204600 $8.80 6404204700 $8.80 6404204800 $8.80 6404204900 $8.80 6404205000 $8.80 6404205100 $8.80 6404205200 $8.80 6404205300 $8.80 6404205400 $8.80 6404205500 $8.80 6404205600 $8.80 6404205700 $8.80 6404205800 $8.80 6404205900 $8.80 6404206000 $8.80 6404206100 $8.80 6404206200 $8.80 6404206300 $8.80 6404210100 $8.80 6404210200 $8.80 6404210300 $8.80 6404210400 $8.80 6404210500 $8.80 6404210600 $8.80 6404210700 $8.80 6404210800 $8.80 6404210900 $8.80 6404211000 $8.80 6404211100 $8.80 6404211200 $8.80 6404211300 $8.80 6404211400 $8.80 6404211500 $8.80 6404211600 $8.80 6404211700 $8.80 6404211800 $8.80 6404211900 $8.80 6404212000 $8.80 6404212100 $8.80 6404212200 $8.80 6404212300 $8.80 6404212400 $8.80 6404212500 $8.80 6404212600 $8.80 6404212700 $8.80 6404212800 $8.80 6404212900 $8.80 6404213000 $8.80 6404213100 $8.80 6404213200 $8.80 Page 100 of 189 City of Chula Vista Engineer's ReportPage 315 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404213300 $8.80 6404213400 $8.80 6404213500 $8.80 6404213600 $8.80 6404213700 $8.80 6404213800 $8.80 6404213900 $8.80 6404214000 $8.80 6404214100 $8.80 6404214200 $8.80 6404214300 $8.80 6404214400 $8.80 6404214500 $8.80 6404214600 $8.80 6404214700 $8.80 6404214800 $8.80 6404214900 $8.80 6404215000 $8.80 6404215100 $8.80 6404215200 $8.80 6404215300 $8.80 6404215400 $8.80 6404215500 $8.80 6404215600 $8.80 6404215700 $8.80 6404215800 $8.80 6404215900 $8.80 6404216000 $8.80 6404216100 $8.80 6404216200 $8.80 6404216300 $8.80 6404216400 $8.80 6404216500 $8.80 6404216600 $8.80 6404216700 $8.80 6404216800 $8.80 6404216900 $8.80 6404217000 $8.80 6404217100 $8.80 6404217200 $8.80 6404217300 $8.80 6404217400 $8.80 6404217500 $8.80 6404217600 $8.80 6404217700 $8.80 6404217800 $8.80 6404217900 $8.80 6404218000 $8.80 6404218100 $8.80 6404218200 $8.80 6404218300 $8.80 6404218400 $8.80 6404218500 $8.80 6404218600 $8.80 6404218700 $8.80 6404218800 $8.80 6404300401 $7.04 6404300402 $7.04 6404300403 $7.04 6404300404 $7.04 6404300405 $7.04 6404300406 $7.04 6404300407 $7.04 6404300408 $7.04 6404300409 $7.04 6404300410 $7.04 6404300411 $7.04 6404300412 $7.04 6404300413 $7.04 6404300414 $7.04 6404300415 $7.04 6404300416 $7.04 6404300417 $7.04 6404300418 $7.04 6404300419 $7.04 6404300420 $7.04 6404300421 $7.04 6404300501 $7.04 6404300502 $7.04 6404300503 $7.04 6404300504 $7.04 6404300505 $7.04 6404300506 $7.04 6404300507 $7.04 6404300508 $7.04 6404300509 $7.04 6404300510 $7.04 6404300511 $7.04 6404300512 $7.04 6404300513 $7.04 6404300514 $7.04 6404300515 $7.04 6404300516 $7.04 6404300517 $7.04 6404300518 $7.04 6404300519 $7.04 6404300520 $7.04 6404300521 $7.04 6404300701 $7.04 6404300702 $7.04 6404300703 $7.04 6404300704 $7.04 6404300705 $7.04 6404300706 $7.04 6404300707 $7.04 6404300708 $7.04 6404300709 $7.04 6404300710 $7.04 6404300711 $7.04 6404300712 $7.04 6404300713 $7.04 6404300714 $7.04 6404300715 $7.04 6404300716 $7.04 6404300717 $7.04 6404300718 $7.04 6404300719 $7.04 6404300720 $7.04 6404300721 $7.04 6404300722 $7.04 6404300723 $7.04 6404300724 $7.04 6404300801 $7.04 6404300802 $7.04 6404300803 $7.04 6404300804 $7.04 6404300805 $7.04 6404300806 $7.04 6404300807 $7.04 6404300808 $7.04 6404300809 $7.04 6404300810 $7.04 6404300811 $7.04 6404300812 $7.04 6404300813 $7.04 6404300814 $7.04 6404300815 $7.04 6404300816 $7.04 6404300817 $7.04 6404300818 $7.04 6404301001 $7.04 Page 101 of 189 City of Chula Vista Engineer's ReportPage 316 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404301002 $7.04 6404301003 $7.04 6404301004 $7.04 6404301005 $7.04 6404301006 $7.04 6404301007 $7.04 6404301008 $7.04 6404301009 $7.04 6404301010 $7.04 6404301011 $7.04 6404301012 $7.04 6404301013 $7.04 6404301014 $7.04 6404301015 $7.04 6404301016 $7.04 6404301017 $7.04 6404301018 $7.04 6404301201 $7.04 6404301202 $7.04 6404301203 $7.04 6404301204 $7.04 6404301205 $7.04 6404301206 $7.04 6404301207 $7.04 6404301208 $7.04 6404301209 $7.04 6404301210 $7.04 6404301211 $7.04 6404301212 $7.04 6404301213 $7.04 6404301214 $7.04 6404301215 $7.04 6404301216 $7.04 6404301217 $7.04 6404301218 $7.04 6404301301 $7.04 6404301302 $7.04 6404301303 $7.04 6404301304 $7.04 6404301305 $7.04 6404301306 $7.04 6404301307 $7.04 6404301308 $7.04 6404301309 $7.04 6404301310 $7.04 6404301311 $7.04 6404301312 $7.04 6404301313 $7.04 6404301314 $7.04 6404301315 $7.04 6404301316 $7.04 6404301317 $7.04 6404301318 $7.04 6404301319 $7.04 6404301320 $7.04 6404301321 $7.04 6404301401 $7.04 6404301402 $7.04 6404301403 $7.04 6404301404 $7.04 6404301405 $7.04 6404301406 $7.04 6404301407 $7.04 6404301408 $7.04 6404301409 $7.04 6404301410 $7.04 6404301411 $7.04 6404301412 $7.04 6404301413 $7.04 6404301414 $7.04 6404301415 $7.04 6404301416 $7.04 6404301417 $7.04 6404301418 $7.04 6404301501 $7.04 6404301502 $7.04 6404301503 $7.04 6404301504 $7.04 6404301505 $7.04 6404301506 $7.04 6404301507 $7.04 6404301508 $7.04 6404301509 $7.04 6404301510 $7.04 6404301511 $7.04 6404301512 $7.04 6404301513 $7.04 6404301514 $7.04 6404301515 $7.04 6404301516 $7.04 6404301517 $7.04 6404301518 $7.04 6404400101 $7.04 6404400102 $7.04 6404400103 $7.04 6404400104 $7.04 6404400105 $7.04 6404400106 $7.04 6404400107 $7.04 6404400108 $7.04 6404400109 $7.04 6404400110 $7.04 6404400111 $7.04 6404400112 $7.04 6404400113 $7.04 6404400114 $7.04 6404400115 $7.04 6404400116 $7.04 6404400117 $7.04 6404400118 $7.04 6404400119 $7.04 6404400120 $7.04 6404400121 $7.04 6404400201 $7.04 6404400202 $7.04 6404400203 $7.04 6404400204 $7.04 6404400205 $7.04 6404400206 $7.04 6404400207 $7.04 6404400208 $7.04 6404400209 $7.04 6404400210 $7.04 6404400211 $7.04 6404400212 $7.04 6404400213 $7.04 6404400214 $7.04 6404400215 $7.04 6404400216 $7.04 6404400217 $7.04 6404400218 $7.04 6404400401 $7.04 6404400402 $7.04 6404400403 $7.04 6404400404 $7.04 6404400405 $7.04 6404400406 $7.04 6404400407 $7.04 6404400408 $7.04 6404400409 $7.04 6404400410 $7.04 Page 102 of 189 City of Chula Vista Engineer's ReportPage 317 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404400411 $7.04 6404400412 $7.04 6404400413 $7.04 6404400414 $7.04 6404400415 $7.04 6404400416 $7.04 6404400417 $7.04 6404400418 $7.04 6404400501 $7.04 6404400502 $7.04 6404400503 $7.04 6404400504 $7.04 6404400505 $7.04 6404400506 $7.04 6420110300 $8.80 6420110400 $8.80 6420110500 $8.80 6420110600 $8.80 6420110700 $8.80 6420110800 $8.80 6420110900 $8.80 6420111000 $8.80 6420111100 $8.80 6420111200 $8.80 6420111300 $8.80 6420111400 $8.80 6420111500 $8.80 6420111600 $8.80 6420111700 $8.80 6420111800 $8.80 6420111900 $8.80 6420112000 $8.80 6420112100 $8.80 6420112200 $8.80 6420112300 $8.80 6420112400 $8.80 6420112500 $8.80 6423800401 $7.04 6423800402 $7.04 6423800403 $7.04 6423800404 $7.04 6423800405 $7.04 6423800406 $7.04 6423800407 $7.04 6423800408 $7.04 6423800409 $7.04 6423800410 $7.04 6423800411 $7.04 6423800412 $7.04 6423800413 $7.04 6423800414 $7.04 6423800415 $7.04 6423800416 $7.04 6423800417 $7.04 6423800418 $7.04 6423800419 $7.04 6423800420 $7.04 6423800421 $7.04 6423800422 $7.04 6423800423 $7.04 6423800424 $7.04 6423800425 $7.04 6423800426 $7.04 6423800427 $7.04 6423800501 $7.04 6423800502 $7.04 6423800503 $7.04 6423800504 $7.04 6423800505 $7.04 6423800506 $7.04 6423800507 $7.04 6423800508 $7.04 6423800509 $7.04 6423800510 $7.04 6423800511 $7.04 6423800512 $7.04 6423800513 $7.04 6423800514 $7.04 6423800515 $7.04 6423800516 $7.04 6423800517 $7.04 6423800518 $7.04 6423800519 $7.04 6423800520 $7.04 6423800521 $7.04 6423800601 $7.04 6423800602 $7.04 6423800603 $7.04 6423800604 $7.04 6423800605 $7.04 6423800606 $7.04 6423800607 $7.04 6423800608 $7.04 6423800609 $7.04 6423800610 $7.04 6423800611 $7.04 6423800612 $7.04 6423800613 $7.04 6423800614 $7.04 6423800615 $7.04 6423800616 $7.04 6423800617 $7.04 6423800618 $7.04 6423800619 $7.04 6423800701 $7.04 6423800702 $7.04 6423800703 $7.04 6423800704 $7.04 6423800705 $7.04 6423800706 $7.04 6423800707 $7.04 6423800708 $7.04 6423800709 $7.04 6423800710 $7.04 6423800711 $7.04 6423800712 $7.04 6423800713 $7.04 6423800714 $7.04 6423800715 $7.04 6423800716 $7.04 6423800717 $7.04 6423800718 $7.04 6423800719 $7.04 6423800720 $7.04 6423800721 $7.04 6423800722 $7.04 6423801001 $7.04 6423801002 $7.04 6423801003 $7.04 6423801101 $7.04 6423801102 $7.04 6423801103 $7.04 6423801104 $7.04 6423801105 $7.04 6423801501 $7.04 6423801502 $7.04 6423801503 $7.04 6423801504 $7.04 6423801505 $7.04 6423801506 $7.04 6423801507 $7.04 Page 103 of 189 City of Chula Vista Engineer's ReportPage 318 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423801508 $7.04 6423801509 $7.04 6423801510 $7.04 6423801511 $7.04 6423801512 $7.04 6423801513 $7.04 6423801514 $7.04 6423801515 $7.04 6423801516 $7.04 6423801517 $7.04 6423801601 $7.04 6423801602 $7.04 6423801603 $7.04 6423801604 $7.04 6423801605 $7.04 6423801606 $7.04 6423801607 $7.04 6423801608 $7.04 6423801609 $7.04 6423801610 $7.04 6423801611 $7.04 6423801612 $7.04 6423801613 $7.04 6423801614 $7.04 6423801615 $7.04 6423801701 $7.04 6423801702 $7.04 6423801703 $7.04 6423801704 $7.04 6423801705 $7.04 6423801706 $7.04 6423801707 $7.04 6423801708 $7.04 6423801709 $7.04 6423801710 $7.04 6423801711 $7.04 6423801712 $7.04 6423801713 $7.04 6423801714 $7.04 6423801715 $7.04 6423801716 $7.04 6423801717 $7.04 6423801718 $7.04 6423920100 $502.60 6423920200 $391.50 6423920300 $312.14 6423921200 $761.84 6423921300 $677.18 6424100101 $7.04 6424100102 $7.04 6424100103 $7.04 6424100104 $7.04 6424100105 $7.04 6424100106 $7.04 6424100107 $7.04 6424100108 $7.04 6424100109 $7.04 6424100110 $7.04 6424100111 $7.04 6424100112 $7.04 6424100113 $7.04 6424100114 $7.04 6424100115 $7.04 6424100116 $7.04 6424100117 $7.04 6424100118 $7.04 6424100119 $7.04 6424100120 $7.04 6424100121 $7.04 6424100122 $7.04 6424100123 $7.04 6424100124 $7.04 6424100301 $7.04 6424100302 $7.04 6424100303 $7.04 6424100304 $7.04 6424100305 $7.04 6424100306 $7.04 6424100307 $7.04 6424100308 $7.04 6424100309 $7.04 6424100310 $7.04 6424100311 $7.04 6424100312 $7.04 6424100313 $7.04 6424100314 $7.04 6424100315 $7.04 6424100316 $7.04 6424100317 $7.04 6424100318 $7.04 6424100319 $7.04 6424100320 $7.04 6424100321 $7.04 6424100322 $7.04 6424100323 $7.04 6424100324 $7.04 6424100325 $7.04 6424100701 $7.04 6424100702 $7.04 6424100703 $7.04 6424100704 $7.04 6424100705 $7.04 6424100706 $7.04 6424100707 $7.04 6424100708 $7.04 6424100709 $7.04 6424100710 $7.04 6424100711 $7.04 6424100712 $7.04 6424100713 $7.04 6424100801 $7.04 6424100802 $7.04 6424100803 $7.04 6424100804 $7.04 6424100805 $7.04 6424100806 $7.04 6424100807 $7.04 6424100808 $7.04 6424100809 $7.04 6424100810 $7.04 6424100811 $7.04 6424100812 $7.04 6424100813 $7.04 6424100814 $7.04 6424100815 $7.04 6424100816 $7.04 6424100817 $7.04 6424100818 $7.04 6424100819 $7.04 6424101301 $7.04 6424101302 $7.04 6424101303 $7.04 6424101304 $7.04 6424101305 $7.04 6424101306 $7.04 6424101307 $7.04 6424101308 $7.04 6424101401 $7.04 6424101402 $7.04 6424101403 $7.04 6424101404 $7.04 Page 104 of 189 City of Chula Vista Engineer's ReportPage 319 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-77 - OSD 20 Zone 3 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6424101405 $7.04 6424101406 $7.04 6424101407 $7.04 6424101408 $7.04 6424101409 $7.04 6424101410 $7.04 6424101411 $7.04 6424101412 $7.04 6424101413 $7.04 6424101414 $7.04 6424101415 $7.04 6424101416 $7.04 6424101501 $7.04 6424101502 $7.04 6424101503 $7.04 6424101504 $7.04 6424101505 $7.04 6424101506 $7.04 6424101507 $7.04 6424101508 $7.04 6424101509 $7.04 6424101510 $7.04 6424101511 $7.04 6424101512 $7.04 6424101513 $7.04 6424101514 $7.04 6424101515 $7.04 6424101516 $7.04 6424101517 $7.04 6424101518 $7.04 6424101601 $7.04 6424101602 $7.04 6424101603 $7.04 6424101604 $7.04 6424101605 $7.04 6424101606 $7.04 6424101607 $7.04 6424101608 $7.04 6424101609 $7.04 6424101610 $7.04 6424101611 $7.04 6424101612 $7.04 6424101613 $7.04 6424101614 $7.04 6424101615 $7.04 Totals Parcels 3,429 Levy $54,123.00 Page 105 of 189 City of Chula Vista Engineer's ReportPage 320 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-78 - OSD 20 Zone 4 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6402910400 $2,971.62 6402910500 $2,198.18 6402910600 $3,704.36 6402911300 $27,395.90 6402921900 $3,704.36 6402922000 $8,752.00 6402923600 $23,284.46 6402923900 $2,462.78 6402924000 $1,953.94 6402924400 $773.42 6402924600 $7,713.96 6402924700 $2,035.36 6402924800 $2,035.36 6402925000 $28,718.84 6402925200 $3,765.42 6402925300 $1,506.16 6402930300 $5,129.12 6402930400 $6,207.86 6402930600 $2,096.42 6402931200 $2,259.24 6402931500 $2,829.16 6402931600 $1,791.12 6402931700 $1,546.86 6402932300 $7,327.32 6402932600 $2,584.90 6402932700 $5,312.30 6402932800 $7,490.14 6402933100 $6,085.74 6402933201 $152.64 6402933202 $152.64 6402933203 $152.64 6402933204 $152.64 6402933205 $152.64 6402933206 $152.64 6402933207 $152.64 6402933208 $152.64 6402933209 $152.64 6402933210 $152.64 6402933211 $152.64 6402933212 $152.64 6402933213 $152.64 6402933214 $152.64 6402933215 $152.64 6402933216 $152.64 6402933217 $152.64 6402933218 $152.64 Totals Parcels 46 Levy $176,383.82 Assessment Roll Page 106 of 189 City of Chula Vista Engineer's ReportPage 321 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5931410100 $495.86 5931410200 $495.86 5931410300 $495.86 5931410400 $495.86 5931410500 $495.86 5931410600 $495.86 5931410700 $495.86 5931410800 $495.86 5931410900 $495.86 5931411000 $495.86 5931411100 $495.86 5931411200 $495.86 5931411300 $495.86 5931411400 $495.86 5931411500 $495.86 5931411600 $495.86 5931411700 $495.86 5931411800 $495.86 5931411900 $495.86 5931412000 $495.86 5931412100 $495.86 5931420100 $495.86 5931420200 $495.86 5931420300 $495.86 5931420400 $495.86 5931420500 $495.86 5931420600 $495.86 5931420700 $495.86 5931420800 $495.86 5931420900 $495.86 5931421000 $495.86 5931421100 $495.86 5931421200 $495.86 5931421300 $495.86 5931421400 $495.86 5931421500 $495.86 5931421600 $495.86 5931421700 $495.86 5931421800 $495.86 5931421900 $495.86 5931422000 $495.86 5931422100 $495.86 5931422200 $495.86 5931422300 $495.86 5931422400 $495.86 5931422500 $495.86 5931422600 $495.86 5931422700 $495.86 5931422800 $495.86 5931422900 $495.86 5931423000 $495.86 5931423100 $495.86 5931423200 $495.86 5931423300 $495.86 5931423400 $495.86 5931423500 $495.86 5931430100 $495.86 5931430300 $495.86 5931430400 $495.86 5931430500 $495.86 5931430600 $495.86 5931430700 $495.86 5931430800 $495.86 5931430900 $495.86 5931431000 $495.86 5931431100 $495.86 5931431200 $495.86 5931431300 $495.86 5931431400 $495.86 5931431500 $495.86 5931431600 $495.86 5931431700 $495.86 5931431800 $495.86 5931431900 $495.86 5931432000 $495.86 5931432100 $495.86 5931432200 $495.86 5931432600 $495.86 5941210100 $495.86 5941210200 $495.86 5941210300 $495.86 5941210400 $495.86 5941210500 $495.86 5941210600 $495.86 5941210700 $495.86 5941210800 $495.86 5941210900 $495.86 5941211000 $495.86 5941211100 $495.86 5941211200 $495.86 5941211300 $495.86 5941211400 $495.86 5941211500 $495.86 5941211600 $495.86 5941211700 $495.86 5941211800 $495.86 5941211900 $495.86 5941212000 $495.86 5941212100 $495.86 5941212200 $495.86 5941212300 $495.86 5941212700 $495.86 5941212800 $495.86 5941212900 $495.86 5941213000 $495.86 5941213100 $495.86 5941213200 $495.86 5941213300 $495.86 5941213400 $495.86 5941213500 $495.86 5941213600 $495.86 5941213700 $495.86 5941213800 $495.86 5941213900 $495.86 5941214000 $495.86 5941214100 $495.86 5941214200 $495.86 5941214300 $495.86 5941214400 $495.86 5941214500 $495.86 5941214600 $495.86 5941214700 $495.86 5941214800 $495.86 5941214900 $495.86 5941215000 $495.86 5941215100 $495.86 5941215200 $495.86 5941215300 $495.86 5941215400 $495.86 5941215500 $495.86 5941215600 $495.86 5941215700 $495.86 5941215800 $495.86 5941215900 $495.86 5941216000 $495.86 5941216100 $495.86 5941216200 $495.86 5941216300 $495.86 5941216400 $495.86 5941216500 $495.86 5941216600 $495.86 Assessment Roll Page 107 of 189 City of Chula Vista Engineer's ReportPage 322 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5941216700 $495.86 5941216800 $495.86 5941216900 $495.86 5941217000 $495.86 5941217100 $495.86 5941217200 $495.86 5941217300 $495.86 5941217400 $495.86 5941217500 $495.86 5941217600 $495.86 5941217700 $495.86 5941218200 $495.86 5941218300 $495.86 5941218400 $495.86 5941220100 $495.86 5941220200 $495.86 5941220300 $495.86 5941220400 $495.86 5941220500 $495.86 5941220600 $495.86 5941220700 $495.86 5941220800 $495.86 5941220900 $495.86 5941221000 $495.86 5941221100 $495.86 5941221200 $495.86 5941221300 $495.86 5941221400 $495.86 5941221500 $495.86 5941221600 $495.86 5941221700 $495.86 5941221800 $495.86 5941221900 $495.86 5941222000 $495.86 5941222100 $495.86 5941222200 $495.86 5941222300 $495.86 5941222400 $495.86 5941222500 $495.86 5941222600 $495.86 5941222700 $495.86 5941222800 $495.86 5941222900 $495.86 5941223000 $495.86 5941223100 $495.86 5941223200 $495.86 5941223300 $495.86 5941223400 $495.86 5941223500 $495.86 5941223600 $495.86 5941223700 $495.86 5941223800 $495.86 5941223900 $495.86 5941224000 $495.86 5941224100 $495.86 5941224200 $495.86 5941224300 $495.86 5941224400 $495.86 5941224500 $495.86 5941224600 $495.86 5941224700 $495.86 5941224800 $495.86 5941224900 $495.86 5941225000 $495.86 5941225100 $495.86 5941225200 $495.86 5941225300 $495.86 5941225400 $495.86 5941225500 $495.86 5941225600 $495.86 5941225700 $495.86 5941225800 $495.86 5941225900 $495.86 5941226000 $495.86 5941226100 $495.86 5941226200 $495.86 5941226300 $495.86 5941226400 $495.86 5941226500 $495.86 5941226600 $495.86 5941226700 $495.86 5941226800 $495.86 5944300100 $495.86 5944300200 $495.86 5944300300 $495.86 5944300400 $495.86 5944300500 $495.86 5944300600 $495.86 5944300700 $495.86 5944300800 $495.86 5944300900 $495.86 5944301000 $495.86 5944301100 $495.86 5944301200 $495.86 5944301300 $495.86 5944301400 $495.86 5944301500 $495.86 5944301600 $495.86 5944301700 $495.86 5944301800 $495.86 5944301900 $495.86 5944302000 $495.86 5944302100 $495.86 5944302200 $495.86 5944302300 $495.86 5944302400 $495.86 5944302500 $495.86 5944302600 $495.86 5944302700 $495.86 5944302800 $495.86 5944302900 $495.86 5944303000 $495.86 5944303100 $495.86 5944303200 $495.86 5944303300 $495.86 5944303400 $495.86 5944303500 $495.86 5944303600 $495.86 5944303700 $495.86 5944303800 $495.86 5944303900 $495.86 5944304000 $495.86 5944304100 $495.86 5944304200 $495.86 5944304300 $495.86 5944304400 $495.86 5944304500 $495.86 5944304600 $495.86 5944304700 $495.86 5944304800 $495.86 5944304900 $495.86 5944305000 $495.86 5944305100 $495.86 5944305200 $495.86 5944305300 $495.86 5944305400 $495.86 5944305500 $495.86 5944305600 $495.86 5944305700 $495.86 5944305800 $495.86 5944305900 $495.86 Page 108 of 189 City of Chula Vista Engineer's ReportPage 323 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944306000 $495.86 5944306100 $495.86 5944306200 $495.86 5944306300 $495.86 5944310100 $495.86 5944310200 $495.86 5944310300 $495.86 5944310400 $495.86 5944310500 $495.86 5944310600 $495.86 5944310700 $495.86 5944310800 $495.86 5944310900 $495.86 5944311000 $495.86 5944311100 $495.86 5944311200 $495.86 5944311300 $495.86 5944311400 $495.86 5944311500 $495.86 5944311600 $495.86 5944311700 $495.86 5944311800 $495.86 5944311900 $495.86 5944312000 $495.86 5944312100 $495.86 5944312200 $495.86 5944312300 $495.86 5944312400 $495.86 5944312500 $495.86 5944312600 $495.86 5944312700 $495.86 5944312800 $495.86 5944312900 $495.86 5944313000 $495.86 5944313100 $495.86 5944313200 $495.86 5944313300 $495.86 5944313400 $495.86 5944313500 $495.86 5944313600 $495.86 5944313700 $495.86 5944313800 $495.86 5944313900 $495.86 5944314000 $495.86 5944314100 $495.86 5944314200 $495.86 5944314300 $495.86 5944314400 $495.86 5944314500 $495.86 5944314600 $495.86 5944314700 $495.86 5944314800 $495.86 5944320200 $495.86 5944320300 $495.86 5944320400 $495.86 5944320500 $495.86 5944320600 $495.86 5944320700 $495.86 5944320800 $495.86 5944320900 $495.86 5944321000 $495.86 5944321100 $495.86 5944321200 $495.86 5944321300 $495.86 5944321400 $495.86 5944321500 $495.86 5944321600 $495.86 5944321700 $495.86 5944321800 $495.86 5944321900 $495.86 5944322000 $495.86 5944322100 $495.86 5944322200 $495.86 5944322300 $495.86 5944322400 $495.86 5944322500 $495.86 5944322600 $495.86 5944322700 $495.86 5944322800 $495.86 5944322900 $495.86 5944323000 $495.86 5944323100 $495.86 5944323200 $495.86 5944323300 $495.86 5944323400 $495.86 5944323500 $495.86 5944323600 $495.86 5944323700 $495.86 5944323800 $495.86 5944323900 $495.86 5944324000 $495.86 5944324100 $495.86 5944324200 $495.86 5944324300 $495.86 5944324400 $495.86 5944324500 $495.86 5944324600 $495.86 5944324700 $495.86 5944324800 $495.86 5944324900 $495.86 5944325000 $495.86 5944325100 $495.86 5944325200 $495.86 5944325300 $495.86 5944325400 $495.86 5944325500 $495.86 5944325600 $495.86 5944325700 $495.86 5944325800 $495.86 5944325900 $495.86 5944326000 $495.86 5944326100 $495.86 5944326200 $495.86 5944326300 $495.86 5944326400 $495.86 5944326500 $495.86 5944326600 $495.86 5944326700 $495.86 5944326800 $495.86 5944326900 $495.86 5944327000 $495.86 5944327100 $495.86 5944327200 $495.86 5944327300 $495.86 5944327400 $495.86 5944327500 $495.86 5944327600 $495.86 5944327700 $495.86 5944327800 $495.86 5944327900 $495.86 5944328000 $495.86 5944328100 $495.86 5944328200 $495.86 5944328300 $495.86 5944328400 $495.86 5944328500 $495.86 5944328600 $495.86 5944328700 $495.86 5944330100 $495.86 5944330200 $495.86 5944330300 $495.86 Page 109 of 189 City of Chula Vista Engineer's ReportPage 324 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5944330400 $495.86 5944330500 $495.86 5944330600 $495.86 5944330700 $495.86 5944330800 $495.86 5944330900 $495.86 5944331000 $495.86 5944331100 $495.86 5944331200 $495.86 5944331300 $495.86 5944331400 $495.86 5944331500 $495.86 5944331600 $495.86 5944331700 $495.86 5944331800 $495.86 5944331900 $495.86 5944332000 $495.86 5944332100 $495.86 5944332200 $495.86 5944332300 $495.86 5944332400 $495.86 5944332500 $495.86 5944332600 $495.86 5944332700 $495.86 5944332800 $495.86 5944332900 $495.86 5944333000 $495.86 5944333100 $495.86 5944333300 $495.86 5944333400 $495.86 5944333500 $495.86 5944333600 $495.86 5944333700 $495.86 5944333800 $495.86 5944333900 $495.86 5944334000 $495.86 5944334100 $495.86 5944334200 $495.86 5944334300 $495.86 5944334400 $495.86 5944334500 $495.86 5944334600 $495.86 5944334700 $495.86 5944334800 $495.86 5944334900 $495.86 5944335000 $495.86 5944335100 $495.86 5944335200 $495.86 5944335300 $495.86 5944335400 $495.86 5944335500 $495.86 5944335600 $495.86 5944335700 $495.86 5944335800 $495.86 5944335900 $495.86 5944336000 $495.86 5944336100 $495.86 5944336200 $495.86 5944336300 $495.86 5944336400 $495.86 5944336500 $495.86 5944336600 $495.86 5944336700 $495.86 5944336800 $495.86 5944336900 $495.86 5944337000 $495.86 5944337100 $495.86 5944337200 $495.86 5944337300 $495.86 5944337400 $495.86 5944337800 $495.86 6400210100 $495.86 6400210200 $495.86 6400210300 $495.86 6400210400 $495.86 6400210500 $495.86 6400210600 $495.86 6400210700 $495.86 6400210800 $495.86 6400211000 $495.86 6400211100 $495.86 6400211200 $495.86 6400211300 $495.86 6400211700 $495.86 6400211800 $495.86 6400211900 $495.86 6400212000 $495.86 6400212100 $495.86 6400212200 $495.86 6400212300 $495.86 6400212400 $495.86 6400212500 $495.86 6400212600 $495.86 6400212700 $495.86 6400212800 $495.86 6400212900 $495.86 6400213000 $495.86 6400213100 $495.86 6400213200 $495.86 6400213300 $495.86 6400213400 $495.86 6400213500 $495.86 6400213600 $495.86 6400213700 $495.86 6400213800 $495.86 6400213900 $495.86 6400214000 $495.86 6400214100 $495.86 6400214200 $495.86 6400214300 $495.86 6400214400 $495.86 6400214500 $495.86 6400214600 $495.86 6400214700 $495.86 6400214800 $495.86 6400214900 $495.86 6400215000 $495.86 6400215100 $495.86 6400215200 $495.86 6400215300 $495.86 6400215400 $495.86 6400215500 $495.86 6400215600 $495.86 6400215700 $495.86 6400215800 $495.86 6400215900 $495.86 6400216000 $495.86 6400216100 $495.86 6400216200 $495.86 6400220100 $495.86 6400220200 $495.86 6400220300 $495.86 6400220400 $495.86 6400220500 $495.86 6400220600 $495.86 6400220700 $495.86 6400220800 $495.86 6400220900 $495.86 6400221000 $495.86 6400221100 $495.86 6400221200 $495.86 Page 110 of 189 City of Chula Vista Engineer's ReportPage 325 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400221300 $495.86 6400221400 $495.86 6400221500 $495.86 6400221600 $495.86 6400221700 $495.86 6400221800 $495.86 6400221900 $495.86 6400222000 $495.86 6400222100 $495.86 6400222200 $495.86 6400222300 $495.86 6400222400 $495.86 6400222500 $495.86 6400222600 $495.86 6400222700 $495.86 6400222800 $495.86 6400222900 $495.86 6400223000 $495.86 6400223100 $495.86 6400223200 $495.86 6400223300 $495.86 6400223400 $495.86 6400223500 $495.86 6400223600 $495.86 6400223700 $495.86 6400223800 $495.86 6400223900 $495.86 6400224000 $495.86 6400224100 $495.86 6400224200 $495.86 6400224300 $495.86 6400224400 $495.86 6400224500 $495.86 6400224600 $495.86 6400224700 $495.86 6400224800 $495.86 6400224900 $495.86 6400225000 $495.86 6400225100 $495.86 6400225200 $495.86 6400225300 $495.86 6400225400 $495.86 6400225500 $495.86 6400225600 $495.86 6400225700 $495.86 6400225800 $495.86 6400225900 $495.86 6400226000 $495.86 6400230100 $495.86 6400230200 $495.86 6400230300 $495.86 6400230400 $495.86 6400230500 $495.86 6400230600 $495.86 6400230700 $495.86 6400230800 $495.86 6400230900 $495.86 6400231000 $495.86 6400231100 $495.86 6400231200 $495.86 6400231300 $495.86 6400231400 $495.86 6400231500 $495.86 6400231600 $495.86 6400231700 $495.86 6400231800 $495.86 6400231900 $495.86 6400232000 $495.86 6400232100 $495.86 6400232200 $495.86 6400232300 $495.86 6400232400 $495.86 6400232500 $495.86 6400232600 $495.86 6400232700 $495.86 6400232800 $495.86 6400232900 $495.86 6400233000 $495.86 6400233100 $495.86 6400233200 $495.86 6400233300 $495.86 6400233400 $495.86 6400233500 $495.86 6400233600 $495.86 6400233700 $495.86 6400233800 $495.86 6400233900 $495.86 6400234000 $495.86 6400234100 $495.86 6400234200 $495.86 6400234300 $495.86 6400234400 $495.86 6400234500 $495.86 6400234600 $495.86 6400234700 $495.86 6400310100 $495.86 6400310200 $495.86 6400310300 $495.86 6400310400 $495.86 6400310500 $495.86 6400310600 $495.86 6400310700 $495.86 6400310800 $495.86 6400310900 $495.86 6400311000 $495.86 6400311100 $495.86 6400311200 $495.86 6400311300 $495.86 6400311400 $495.86 6400311500 $495.86 6400311600 $495.86 6400311700 $495.86 6400311800 $495.86 6400311900 $495.86 6400312000 $495.86 6400312100 $495.86 6400312200 $495.86 6400312300 $495.86 6400312400 $495.86 6400312500 $495.86 6400312600 $495.86 6400312700 $495.86 6400312800 $495.86 6400312900 $495.86 6400313000 $495.86 6400313100 $495.86 6400313200 $495.86 6400313300 $495.86 6400313400 $495.86 6400313500 $495.86 6400313600 $495.86 6400313700 $495.86 6400313800 $495.86 6400313900 $495.86 6400314000 $495.86 6400314100 $495.86 6400314200 $495.86 6400314300 $495.86 6400314400 $495.86 6400314500 $495.86 6400314600 $495.86 Page 111 of 189 City of Chula Vista Engineer's ReportPage 326 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6400314700 $495.86 6400314800 $495.86 6400314900 $495.86 6400315000 $495.86 6400315100 $495.86 6400315200 $495.86 6400315300 $495.86 6400315400 $495.86 6400315500 $495.86 6400320100 $495.86 6400320200 $495.86 6400320300 $495.86 6400320400 $495.86 6400320500 $495.86 6400320600 $495.86 6400320700 $495.86 6400320800 $495.86 6400320900 $495.86 6400321000 $495.86 6400321100 $495.86 6400321200 $495.86 6400321300 $495.86 6400321400 $495.86 6400321500 $495.86 6400321800 $495.86 6400321900 $495.86 6400322000 $495.86 6400322100 $495.86 6400322200 $495.86 6400322300 $495.86 6400322400 $495.86 6400322500 $495.86 6400322600 $495.86 6400322700 $495.86 6400322800 $495.86 6400322900 $495.86 6400323000 $495.86 6400323100 $495.86 6400323200 $495.86 6400323300 $495.86 6400323400 $495.86 6400323500 $495.86 6400323600 $495.86 6400323700 $495.86 6400323800 $495.86 6400323900 $495.86 6400324000 $495.86 6400324100 $495.86 6400324200 $495.86 6400324300 $495.86 6400324400 $495.86 6400324500 $495.86 6400324600 $495.86 6400324700 $495.86 6400324800 $495.86 6400324900 $495.86 6400325000 $495.86 6400325100 $495.86 6400325200 $495.86 6400325300 $495.86 6400325400 $495.86 6400325500 $495.86 6400325600 $495.86 6400325700 $495.86 6400325800 $495.86 6400325900 $495.86 6400326300 $495.86 6400326400 $495.86 6400330100 $495.86 6400330200 $495.86 6400330300 $495.86 6400330400 $495.86 6400330500 $495.86 6400330600 $495.86 6400330700 $495.86 6400330800 $495.86 6400330900 $495.86 6400331000 $495.86 6400331100 $495.86 6400331200 $495.86 6400331300 $495.86 6400331400 $495.86 6400331500 $495.86 6400331600 $495.86 6400331700 $495.86 6400331800 $495.86 6400331900 $495.86 6400332000 $495.86 6400332100 $495.86 6400332200 $495.86 6400332300 $495.86 6400332400 $495.86 6400332500 $495.86 6400332600 $495.86 6400332700 $495.86 6400332800 $495.86 6400332900 $495.86 6400333000 $495.86 6400333100 $495.86 6400333200 $495.86 6400333300 $495.86 6400333400 $495.86 6400333500 $495.86 6400333600 $495.86 6400333700 $495.86 6400333800 $495.86 6400333900 $495.86 6400334000 $495.86 6400334100 $495.86 6400334200 $495.86 6400334300 $495.86 6400334400 $495.86 6400334500 $495.86 6400334600 $495.86 6400334700 $495.86 6400334800 $495.86 6400334900 $495.86 6400335000 $495.86 6400335100 $495.86 6400335200 $495.86 6400335300 $495.86 6400335400 $495.86 6400335500 $495.86 6400335600 $495.86 6400335700 $495.86 6400335800 $495.86 6400335900 $495.86 6400336000 $495.86 6400336100 $495.86 6403100100 $495.86 6403100200 $495.86 6403100300 $495.86 6403100400 $495.86 6403100500 $495.86 6403100600 $495.86 6403100700 $495.86 6403100800 $495.86 6403100900 $495.86 6403101000 $495.86 6403101100 $495.86 6403101200 $495.86 Page 112 of 189 City of Chula Vista Engineer's ReportPage 327 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403101300 $495.86 6403101400 $495.86 6403101500 $495.86 6403101600 $495.86 6403101700 $495.86 6403101800 $495.86 6403101900 $495.86 6403102000 $495.86 6403102100 $495.86 6403102200 $495.86 6403102300 $495.86 6403102400 $495.86 6403102500 $495.86 6403102600 $495.86 6403102700 $495.86 6403102800 $495.86 6403102900 $495.86 6403103000 $495.86 6403103100 $495.86 6403103200 $495.86 6403103300 $495.86 6403103400 $495.86 6403103500 $495.86 6403103600 $495.86 6403103700 $495.86 6403103800 $495.86 6403103900 $495.86 6403104000 $495.86 6403104100 $495.86 6403104200 $495.86 6403104300 $495.86 6403104400 $495.86 6403104500 $495.86 6403104600 $495.86 6403104700 $495.86 6403104800 $495.86 6403104900 $495.86 6403105000 $495.86 6403105100 $495.86 6403105200 $495.86 6403105300 $495.86 6403105400 $495.86 6403105500 $495.86 6403105600 $495.86 6403105700 $495.86 6403105800 $495.86 6403105900 $495.86 6403106000 $495.86 6403106100 $495.86 6403106200 $495.86 6403106300 $495.86 6403106400 $495.86 6403106500 $495.86 6403106600 $495.86 6403106700 $495.86 6403106800 $495.86 6403106900 $495.86 6403107000 $495.86 6403107100 $495.86 6403107200 $495.86 6403107300 $495.86 6403107400 $495.86 6403107500 $495.86 6403107600 $495.86 6403107700 $495.86 6403107800 $495.86 6403107900 $495.86 6403108000 $495.86 6403108100 $495.86 6403108200 $495.86 6403108300 $495.86 6403108400 $495.86 6403108500 $495.86 6403108600 $495.86 6403108700 $495.86 6403108800 $495.86 6403108900 $495.86 6403109000 $495.86 6403109100 $495.86 6403110100 $495.86 6403110200 $495.86 6403110300 $495.86 6403110400 $495.86 6403110500 $495.86 6403110600 $495.86 6403110700 $495.86 6403110800 $495.86 6403110900 $495.86 6403111000 $495.86 6403111100 $495.86 6403111200 $495.86 6403111300 $495.86 6403111400 $495.86 6403111500 $495.86 6403111600 $495.86 6403111700 $495.86 6403111800 $495.86 6403111900 $495.86 6403112000 $495.86 6403112100 $495.86 6403112200 $495.86 6403112300 $495.86 6403112400 $495.86 6403112500 $495.86 6403112600 $495.86 6403112700 $495.86 6403112800 $495.86 6403112900 $495.86 6403113000 $495.86 6403113100 $495.86 6403113200 $495.86 6403113300 $495.86 6403113400 $495.86 6403113500 $495.86 6403113600 $495.86 6403113700 $495.86 6403113800 $495.86 6403113900 $495.86 6403114000 $495.86 6403114100 $495.86 6403114200 $495.86 6403114300 $495.86 6403114400 $495.86 6403114500 $495.86 6403114600 $495.86 6403114700 $495.86 6403114800 $495.86 6403114900 $495.86 6403115000 $495.86 6403115100 $495.86 6403115200 $495.86 6403115300 $495.86 6403115400 $495.86 6403115500 $495.86 6403115600 $495.86 6403115700 $495.86 6403115800 $495.86 6403115900 $495.86 6403116000 $495.86 6403116100 $495.86 6403116200 $495.86 Page 113 of 189 City of Chula Vista Engineer's ReportPage 328 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403116300 $495.86 6403116400 $495.86 6403116500 $495.86 6403116600 $495.86 6403116700 $495.86 6403116800 $495.86 6403116900 $495.86 6403117000 $495.86 6403117100 $495.86 6403117200 $495.86 6403117300 $495.86 6403117400 $495.86 6403117500 $495.86 6403117600 $495.86 6403210100 $495.86 6403210200 $495.86 6403210300 $495.86 6403210400 $495.86 6403210500 $495.86 6403210600 $495.86 6403210700 $495.86 6403210800 $495.86 6403210900 $495.86 6403211000 $495.86 6403211100 $495.86 6403211200 $495.86 6403211300 $495.86 6403211400 $495.86 6403211500 $495.86 6403211600 $495.86 6403211700 $495.86 6403211800 $495.86 6403211900 $495.86 6403212000 $495.86 6403212100 $495.86 6403212200 $495.86 6403212300 $495.86 6403212400 $495.86 6403220100 $495.86 6403220200 $495.86 6403220300 $495.86 6403220400 $495.86 6403220500 $495.86 6403220600 $495.86 6403220700 $495.86 6403220800 $495.86 6403220900 $495.86 6403221000 $495.86 6403221100 $495.86 6403221200 $495.86 6403221300 $495.86 6403221400 $495.86 6403221500 $495.86 6403221600 $495.86 6403221700 $495.86 6403221800 $495.86 6403221900 $495.86 6403222000 $495.86 6403222100 $495.86 6403222200 $495.86 6403222300 $495.86 6403222400 $495.86 6403222500 $495.86 6403222600 $495.86 6403222700 $495.86 6403222800 $495.86 6403222900 $495.86 6403223000 $495.86 6403223100 $495.86 6403223200 $495.86 6403223300 $495.86 6403223400 $495.86 6403223500 $495.86 6403223600 $495.86 6403223700 $495.86 6403223800 $495.86 6403223900 $495.86 6403224000 $495.86 6403224100 $495.86 6403224200 $495.86 6403230100 $495.86 6403230200 $495.86 6403230300 $495.86 6403230400 $495.86 6403230500 $495.86 6403230600 $495.86 6403230700 $495.86 6403230800 $495.86 6403230900 $495.86 6403231000 $495.86 6403231100 $495.86 6403231200 $495.86 6403231300 $495.86 6403231400 $495.86 6403231500 $495.86 6403231600 $495.86 6403231700 $495.86 6403231800 $495.86 6403231900 $495.86 6403232000 $495.86 6403232100 $495.86 6403232200 $495.86 6403232300 $495.86 6403232400 $495.86 6403232500 $495.86 6403232600 $495.86 6403232700 $495.86 6403232800 $495.86 6403232900 $495.86 6403233000 $495.86 6403233100 $495.86 6403233200 $495.86 6403233300 $495.86 6403233400 $495.86 6403233500 $495.86 6403233600 $495.86 6403233700 $495.86 6403233800 $495.86 6403233900 $495.86 6403234000 $495.86 6403300101 $396.68 6403300102 $396.68 6403300103 $396.68 6403300104 $396.68 6403300105 $396.68 6403300106 $396.68 6403300107 $396.68 6403300108 $396.68 6403300109 $396.68 6403300110 $396.68 6403300111 $396.68 6403300201 $396.68 6403300202 $396.68 6403300203 $396.68 6403300204 $396.68 6403300205 $396.68 6403300206 $396.68 6403300207 $396.68 6403300301 $396.68 6403300302 $396.68 6403300303 $396.68 Page 114 of 189 City of Chula Vista Engineer's ReportPage 329 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403300304 $396.68 6403300305 $396.68 6403300306 $396.68 6403300307 $396.68 6403300308 $396.68 6403300401 $396.68 6403300402 $396.68 6403300403 $396.68 6403300404 $396.68 6403300405 $396.68 6403300406 $396.68 6403300407 $396.68 6403300408 $396.68 6403300501 $396.68 6403300502 $396.68 6403300503 $396.68 6403300504 $396.68 6403300505 $396.68 6403300506 $396.68 6403300601 $396.68 6403300602 $396.68 6403300603 $396.68 6403300604 $396.68 6403300605 $396.68 6403300606 $396.68 6403300701 $396.68 6403300702 $396.68 6403300703 $396.68 6403300704 $396.68 6403300705 $396.68 6403300706 $396.68 6403300707 $396.68 6403301101 $396.68 6403301102 $396.68 6403301103 $396.68 6403301104 $396.68 6403301105 $396.68 6403301106 $396.68 6403301107 $396.68 6403301201 $396.68 6403301202 $396.68 6403301203 $396.68 6403301204 $396.68 6403301205 $396.68 6403301206 $396.68 6403301207 $396.68 6403301301 $396.68 6403301302 $396.68 6403301303 $396.68 6403301304 $396.68 6403301305 $396.68 6403301306 $396.68 6403301307 $396.68 6403301401 $396.68 6403301402 $396.68 6403301403 $396.68 6403301404 $396.68 6403301405 $396.68 6403301406 $396.68 6403301407 $396.68 6403301408 $396.68 6403301409 $396.68 6403301501 $396.68 6403301502 $396.68 6403301503 $396.68 6403301504 $396.68 6403301505 $396.68 6403301506 $396.68 6403301507 $396.68 6403301601 $396.68 6403301602 $396.68 6403301603 $396.68 6403301604 $396.68 6403301605 $396.68 6403301606 $396.68 6403301607 $396.68 6403301608 $396.68 6403301701 $396.68 6403301702 $396.68 6403301703 $396.68 6403301704 $396.68 6403301705 $396.68 6403301706 $396.68 6403301707 $396.68 6403301801 $396.68 6403301802 $396.68 6403301803 $396.68 6403301804 $396.68 6403301805 $396.68 6403301806 $396.68 6403301807 $396.68 6403301808 $396.68 6403301901 $396.68 6403301902 $396.68 6403301903 $396.68 6403301904 $396.68 6403301905 $396.68 6403301906 $396.68 6403301907 $396.68 6403301908 $396.68 6403302001 $396.68 6403302002 $396.68 6403302003 $396.68 6403302004 $396.68 6403302005 $396.68 6403302101 $396.68 6403302102 $396.68 6403302103 $396.68 6403302104 $396.68 6403302105 $396.68 6403302106 $396.68 6403302107 $396.68 6403302108 $396.68 6403302201 $396.68 6403302202 $396.68 6403302203 $396.68 6403302204 $396.68 6403302205 $396.68 6403302206 $396.68 6403302207 $396.68 6403302301 $396.68 6403302302 $396.68 6403302303 $396.68 6403302304 $396.68 6403302305 $396.68 6403302306 $396.68 6403302401 $396.68 6403302402 $396.68 6403302403 $396.68 6403302404 $396.68 6403302405 $396.68 6403302406 $396.68 6403302407 $396.68 6403302501 $396.68 6403302502 $396.68 6403302503 $396.68 6403302504 $396.68 6403302505 $396.68 6403302506 $396.68 6403302507 $396.68 6403302508 $396.68 Page 115 of 189 City of Chula Vista Engineer's ReportPage 330 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403302601 $396.68 6403302602 $396.68 6403302603 $396.68 6403302604 $396.68 6403302605 $396.68 6403302606 $396.68 6403302607 $396.68 6403302608 $396.68 6403302701 $396.68 6403302702 $396.68 6403302703 $396.68 6403302704 $396.68 6403302705 $396.68 6403302706 $396.68 6403302707 $396.68 6403304201 $396.68 6403304202 $396.68 6403304203 $396.68 6403304204 $396.68 6403304205 $396.68 6403304206 $396.68 6403304207 $396.68 6403304301 $396.68 6403304302 $396.68 6403304303 $396.68 6403304304 $396.68 6403304305 $396.68 6403304306 $396.68 6403304307 $396.68 6403304308 $396.68 6403304309 $396.68 6403304401 $396.68 6403304402 $396.68 6403304403 $396.68 6403304404 $396.68 6403304405 $396.68 6403304406 $396.68 6403304407 $396.68 6423800401 $396.68 6423800402 $396.68 6423800403 $396.68 6423800404 $396.68 6423800405 $396.68 6423800406 $396.68 6423800407 $396.68 6423800408 $396.68 6423800409 $396.68 6423800410 $396.68 6423800411 $396.68 6423800412 $396.68 6423800413 $396.68 6423800414 $396.68 6423800415 $396.68 6423800416 $396.68 6423800417 $396.68 6423800418 $396.68 6423800419 $396.68 6423800420 $396.68 6423800421 $396.68 6423800422 $396.68 6423800423 $396.68 6423800424 $396.68 6423800425 $396.68 6423800426 $396.68 6423800427 $396.68 6423800501 $396.68 6423800502 $396.68 6423800503 $396.68 6423800504 $396.68 6423800505 $396.68 6423800506 $396.68 6423800507 $396.68 6423800508 $396.68 6423800509 $396.68 6423800510 $396.68 6423800511 $396.68 6423800512 $396.68 6423800513 $396.68 6423800514 $396.68 6423800515 $396.68 6423800516 $396.68 6423800517 $396.68 6423800518 $396.68 6423800519 $396.68 6423800520 $396.68 6423800521 $396.68 6423800601 $396.68 6423800602 $396.68 6423800603 $396.68 6423800604 $396.68 6423800605 $396.68 6423800606 $396.68 6423800607 $396.68 6423800608 $396.68 6423800609 $396.68 6423800610 $396.68 6423800611 $396.68 6423800612 $396.68 6423800613 $396.68 6423800614 $396.68 6423800615 $396.68 6423800616 $396.68 6423800617 $396.68 6423800618 $396.68 6423800619 $396.68 6423800701 $396.68 6423800702 $396.68 6423800703 $396.68 6423800704 $396.68 6423800705 $396.68 6423800706 $396.68 6423800707 $396.68 6423800708 $396.68 6423800709 $396.68 6423800710 $396.68 6423800711 $396.68 6423800712 $396.68 6423800713 $396.68 6423800714 $396.68 6423800715 $396.68 6423800716 $396.68 6423800717 $396.68 6423800718 $396.68 6423800719 $396.68 6423800720 $396.68 6423800721 $396.68 6423800722 $396.68 6423801001 $396.68 6423801002 $396.68 6423801003 $396.68 6423801101 $396.68 6423801102 $396.68 6423801103 $396.68 6423801104 $396.68 6423801105 $396.68 6423801501 $396.68 6423801502 $396.68 6423801503 $396.68 6423801504 $396.68 6423801505 $396.68 6423801506 $396.68 Page 116 of 189 City of Chula Vista Engineer's ReportPage 331 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6423801507 $396.68 6423801508 $396.68 6423801509 $396.68 6423801510 $396.68 6423801511 $396.68 6423801512 $396.68 6423801513 $396.68 6423801514 $396.68 6423801515 $396.68 6423801516 $396.68 6423801517 $396.68 6423801601 $396.68 6423801602 $396.68 6423801603 $396.68 6423801604 $396.68 6423801605 $396.68 6423801606 $396.68 6423801607 $396.68 6423801608 $396.68 6423801609 $396.68 6423801610 $396.68 6423801611 $396.68 6423801612 $396.68 6423801613 $396.68 6423801614 $396.68 6423801615 $396.68 6423801701 $396.68 6423801702 $396.68 6423801703 $396.68 6423801704 $396.68 6423801705 $396.68 6423801706 $396.68 6423801707 $396.68 6423801708 $396.68 6423801709 $396.68 6423801710 $396.68 6423801711 $396.68 6423801712 $396.68 6423801713 $396.68 6423801714 $396.68 6423801715 $396.68 6423801716 $396.68 6423801717 $396.68 6423801718 $396.68 6423920100 $28,264.30 6423920200 $22,016.40 6423920300 $17,553.62 6423921200 $42,842.74 6423921300 $38,082.44 6424100101 $396.68 6424100102 $396.68 6424100103 $396.68 6424100104 $396.68 6424100105 $396.68 6424100106 $396.68 6424100107 $396.68 6424100108 $396.68 6424100109 $396.68 6424100110 $396.68 6424100111 $396.68 6424100112 $396.68 6424100113 $396.68 6424100114 $396.68 6424100115 $396.68 6424100116 $396.68 6424100117 $396.68 6424100118 $396.68 6424100119 $396.68 6424100120 $396.68 6424100121 $396.68 6424100122 $396.68 6424100123 $396.68 6424100124 $396.68 6424100301 $396.68 6424100302 $396.68 6424100303 $396.68 6424100304 $396.68 6424100305 $396.68 6424100306 $396.68 6424100307 $396.68 6424100308 $396.68 6424100309 $396.68 6424100310 $396.68 6424100311 $396.68 6424100312 $396.68 6424100313 $396.68 6424100314 $396.68 6424100315 $396.68 6424100316 $396.68 6424100317 $396.68 6424100318 $396.68 6424100319 $396.68 6424100320 $396.68 6424100321 $396.68 6424100322 $396.68 6424100323 $396.68 6424100324 $396.68 6424100325 $396.68 6424100701 $396.68 6424100702 $396.68 6424100703 $396.68 6424100704 $396.68 6424100705 $396.68 6424100706 $396.68 6424100707 $396.68 6424100708 $396.68 6424100709 $396.68 6424100710 $396.68 6424100711 $396.68 6424100712 $396.68 6424100713 $396.68 6424100801 $396.68 6424100802 $396.68 6424100803 $396.68 6424100804 $396.68 6424100805 $396.68 6424100806 $396.68 6424100807 $396.68 6424100808 $396.68 6424100809 $396.68 6424100810 $396.68 6424100811 $396.68 6424100812 $396.68 6424100813 $396.68 6424100814 $396.68 6424100815 $396.68 6424100816 $396.68 6424100817 $396.68 6424100818 $396.68 6424100819 $396.68 6424101301 $396.68 6424101302 $396.68 6424101303 $396.68 6424101304 $396.68 6424101305 $396.68 6424101306 $396.68 6424101307 $396.68 6424101308 $396.68 6424101401 $396.68 6424101402 $396.68 6424101403 $396.68 Page 117 of 189 City of Chula Vista Engineer's ReportPage 332 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-79 - OSD 20 Zone 5 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6424101404 $396.68 6424101405 $396.68 6424101406 $396.68 6424101407 $396.68 6424101408 $396.68 6424101409 $396.68 6424101410 $396.68 6424101411 $396.68 6424101412 $396.68 6424101413 $396.68 6424101414 $396.68 6424101415 $396.68 6424101416 $396.68 6424101501 $396.68 6424101502 $396.68 6424101503 $396.68 6424101504 $396.68 6424101505 $396.68 6424101506 $396.68 6424101507 $396.68 6424101508 $396.68 6424101509 $396.68 6424101510 $396.68 6424101511 $396.68 6424101512 $396.68 6424101513 $396.68 6424101514 $396.68 6424101515 $396.68 6424101516 $396.68 6424101517 $396.68 6424101518 $396.68 6424101601 $396.68 6424101602 $396.68 6424101603 $396.68 6424101604 $396.68 6424101605 $396.68 6424101606 $396.68 6424101607 $396.68 6424101608 $396.68 6424101609 $396.68 6424101610 $396.68 6424101611 $396.68 6424101612 $396.68 6424101613 $396.68 6424101614 $396.68 6424101615 $396.68 Totals Parcels 1,597 Levy $890,066.32 Page 118 of 189 City of Chula Vista Engineer's ReportPage 333 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-80 - OSD 20 Zone 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5933600100 $380.98 5933600200 $380.98 5933600300 $380.98 5933600400 $380.98 5933600500 $380.98 5933600600 $380.98 5933600700 $380.98 5933600800 $380.98 5933600900 $380.98 5933601000 $380.98 5933601100 $380.98 5933601200 $380.98 5933601300 $380.98 5933601400 $380.98 5933601500 $380.98 5933601600 $380.98 5933601700 $380.98 5933601800 $380.98 5933601900 $380.98 5933602000 $380.98 5933602100 $380.98 5933602200 $380.98 5933602300 $380.98 5933602400 $380.98 5933602500 $380.98 5933602600 $380.98 5933602700 $380.98 5933602800 $380.98 5933602900 $380.98 5933603000 $380.98 5933603100 $380.98 5933610100 $380.98 5933610200 $380.98 5933610300 $380.98 5933610400 $380.98 5933610500 $380.98 5933610600 $380.98 5933610700 $380.98 5933610800 $380.98 5933610900 $380.98 5933611000 $380.98 5933611100 $380.98 5933611200 $380.98 5933611300 $380.98 5933611400 $380.98 5933611500 $380.98 5933611600 $380.98 5933611700 $380.98 5933611800 $380.98 5933611900 $380.98 5933612000 $380.98 5933612100 $380.98 5933612200 $380.98 5933612300 $380.98 5933612400 $380.98 5933612500 $380.98 5933612600 $380.98 5933612700 $380.98 5933612800 $380.98 5933612900 $380.98 5933620100 $380.98 5933620200 $380.98 5933620300 $380.98 5933620400 $380.98 5933620500 $380.98 5933620600 $380.98 5933620700 $380.98 5933620800 $380.98 5933620900 $380.98 5933621000 $380.98 5933621100 $380.98 5933621200 $380.98 5933621300 $380.98 5933621400 $380.98 5933621500 $380.98 5933621600 $380.98 5933621700 $380.98 5933622200 $380.98 5933622300 $380.98 5933700100 $380.98 5933700200 $380.98 5933700300 $380.98 5933700400 $380.98 5933700500 $380.98 5933700600 $380.98 5933700700 $380.98 5933700800 $380.98 5933700900 $380.98 5933701000 $380.98 5933701100 $380.98 5933701200 $380.98 5933701300 $380.98 5933701400 $380.98 5933701500 $380.98 5933701600 $380.98 5933701700 $380.98 5933701800 $380.98 5933701900 $380.98 5933702000 $380.98 5933702100 $380.98 5933702200 $380.98 5933702300 $380.98 5933702400 $380.98 5933702500 $380.98 5933702600 $380.98 5933702700 $380.98 5933702800 $380.98 5933702900 $380.98 5933703000 $380.98 5933703100 $380.98 5933703200 $380.98 5933703300 $380.98 5933703400 $380.98 5933703500 $380.98 5933703600 $380.98 5933703700 $380.98 5933703800 $380.98 5933703900 $380.98 5933704000 $380.98 5933704100 $380.98 5933704200 $380.98 5933704300 $380.98 5933704400 $380.98 5933704500 $380.98 5933704600 $380.98 5933704700 $380.98 5933704800 $380.98 5933710100 $380.98 5933710200 $380.98 5933710300 $380.98 5933710400 $380.98 5933710500 $380.98 5933710600 $380.98 5933710700 $380.98 5933710800 $380.98 5933710900 $380.98 5933711000 $380.98 5933711100 $380.98 5933711200 $380.98 5933711300 $380.98 5933711400 $380.98 Assessment Roll Page 119 of 189 City of Chula Vista Engineer's ReportPage 334 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-80 - OSD 20 Zone 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933711500 $380.98 5933711600 $380.98 5933711700 $380.98 5933711800 $380.98 5933711900 $380.98 5933712000 $380.98 5933712100 $380.98 5933712200 $380.98 5933712300 $380.98 5933712400 $380.98 5933712500 $380.98 5933712600 $380.98 5933712700 $380.98 5933712800 $380.98 5933712900 $380.98 5933713000 $380.98 5933713100 $380.98 5933713200 $380.98 5933713300 $380.98 5933713400 $380.98 5933713500 $380.98 5933713600 $380.98 5933713700 $380.98 5933713800 $380.98 5933713900 $380.98 5933714000 $380.98 5933714100 $380.98 5933714200 $380.98 5933714300 $380.98 5933714400 $380.98 5933714500 $380.98 5933714600 $380.98 5933714700 $380.98 5933714800 $380.98 5933714900 $380.98 5933715000 $380.98 5933715100 $380.98 5933715200 $380.98 5933715300 $380.98 5933715400 $380.98 5933715500 $380.98 5933715600 $380.98 5933715700 $380.98 5933715800 $380.98 5933715900 $380.98 5933716000 $380.98 5933716100 $380.98 5933716200 $380.98 5933716300 $380.98 5933716400 $380.98 5933716500 $380.98 5933716600 $380.98 5933716700 $380.98 5933716800 $380.98 5933716900 $380.98 5933717000 $380.98 5933717100 $380.98 5933717200 $380.98 5933717300 $380.98 5933717500 $380.98 5933717600 $380.98 5933717700 $380.98 5933717800 $380.98 5933717900 $380.98 5933718000 $380.98 5933718100 $380.98 5933718200 $380.98 5933718300 $380.98 5933718400 $380.98 5933718500 $380.98 5933720100 $380.98 5933720200 $380.98 5933720300 $380.98 5933720400 $380.98 5933720500 $380.98 5933720600 $380.98 5933720700 $380.98 5933720800 $380.98 5933720900 $380.98 5933721000 $380.98 5933721100 $380.98 5933721200 $380.98 5933721300 $380.98 5933721400 $380.98 5933721500 $380.98 5933721600 $380.98 5933721700 $380.98 5933721800 $380.98 5933721900 $380.98 5933722000 $380.98 5933722100 $380.98 5933722200 $380.98 5933722300 $380.98 5933722400 $380.98 5933722500 $380.98 5933722600 $380.98 5933722700 $380.98 5933722800 $380.98 5933722900 $380.98 5933723000 $380.98 5933723100 $380.98 5933723200 $380.98 5933723300 $380.98 5933723400 $380.98 5933723500 $380.98 5933723600 $380.98 5933723700 $380.98 5933723800 $380.98 5933723900 $380.98 5933724000 $380.98 5933724100 $380.98 5933724200 $380.98 5933724300 $380.98 5933724400 $380.98 5933724500 $380.98 5933724600 $380.98 5933724700 $380.98 5933724800 $380.98 5933724900 $380.98 5933725000 $380.98 5933725100 $380.98 5933725200 $380.98 5933725300 $380.98 5933725400 $380.98 5933725500 $380.98 5933725600 $380.98 5933730100 $380.98 5933730200 $380.98 5933730300 $380.98 5933730400 $380.98 5933730500 $380.98 5933730600 $380.98 5933730700 $380.98 5933730800 $380.98 5933730900 $380.98 5933731000 $380.98 5933731100 $380.98 5933731200 $380.98 5933731300 $380.98 5933731400 $380.98 5933731500 $380.98 Page 120 of 189 City of Chula Vista Engineer's ReportPage 335 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-80 - OSD 20 Zone 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933731600 $380.98 5933731700 $380.98 5933731800 $380.98 5933731900 $380.98 5933732000 $380.98 5933732100 $380.98 5933732200 $380.98 5933732300 $380.98 5933732400 $380.98 5933732500 $380.98 5933732600 $380.98 5933732700 $380.98 5933732800 $380.98 5933732900 $380.98 5933733000 $380.98 5933733100 $380.98 5933733200 $380.98 5933733300 $380.98 5933733400 $380.98 5933733500 $380.98 5933733600 $380.98 5933733700 $380.98 5933733800 $380.98 5933733900 $380.98 5933734000 $380.98 5933734100 $380.98 5933734200 $380.98 5933734300 $380.98 5933734400 $380.98 5933734500 $380.98 5933734600 $380.98 5933734700 $380.98 5933734800 $380.98 5933734900 $380.98 5933735000 $380.98 5933735100 $380.98 5933735200 $380.98 5933735300 $380.98 5933735400 $380.98 5933735500 $380.98 5933735600 $380.98 5933735700 $380.98 5933735800 $380.98 5933735900 $380.98 5933736000 $380.98 5933736100 $380.98 5933800100 $380.98 5933800200 $380.98 5933800300 $380.98 5933800400 $380.98 5933800500 $380.98 5933800600 $380.98 5933800700 $380.98 5933800800 $380.98 5933800900 $380.98 5933801000 $380.98 5933801100 $380.98 5933801200 $380.98 5933801300 $380.98 5933801400 $380.98 5933801500 $380.98 5933801600 $380.98 5933801700 $380.98 5933801800 $380.98 5933801900 $380.98 5933802000 $380.98 5933802100 $380.98 5933802200 $380.98 5933802300 $380.98 5933802400 $380.98 5933802500 $380.98 5933802600 $380.98 5933802700 $380.98 5933802800 $380.98 5933802900 $380.98 5933803000 $380.98 5933803100 $380.98 5933803200 $380.98 5933803300 $380.98 5933810100 $380.98 5933810200 $380.98 5933810300 $380.98 5933810400 $380.98 5933810500 $380.98 5933810600 $380.98 5933810700 $380.98 5933810800 $380.98 5933810900 $380.98 5933811000 $380.98 5933811100 $380.98 5933811200 $380.98 5933811300 $380.98 5933811400 $380.98 5933811500 $380.98 5933811600 $380.98 5933811700 $380.98 5933811800 $380.98 5933811900 $380.98 5933812000 $380.98 5933812100 $380.98 5933812200 $380.98 5933812300 $380.98 5933812400 $380.98 5933812500 $380.98 5933812600 $380.98 5933812700 $380.98 5933812800 $380.98 5933812900 $380.98 5933813000 $380.98 5933813100 $380.98 5933813200 $380.98 5933813300 $380.98 5933813400 $380.98 5933813500 $380.98 5933813600 $380.98 5933813700 $380.98 5933820100 $380.98 5933820200 $380.98 5933820300 $380.98 5933820400 $380.98 5933820500 $380.98 5933820600 $380.98 5933820700 $380.98 5933820800 $380.98 5933820900 $380.98 5933821000 $380.98 5933821100 $380.98 5933821200 $380.98 5933821300 $380.98 5933821400 $380.98 5933821500 $380.98 5933821600 $380.98 5933821700 $380.98 5933821800 $380.98 5933821900 $380.98 5933822000 $380.98 5933822100 $380.98 5933822200 $380.98 5933822300 $380.98 5933822400 $380.98 5933822500 $380.98 Page 121 of 189 City of Chula Vista Engineer's ReportPage 336 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-80 - OSD 20 Zone 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5933822600 $380.98 5933822700 $380.98 5933822800 $380.98 5933822900 $380.98 5933823000 $380.98 5933823100 $380.98 5933823200 $380.98 5933823300 $380.98 5933823400 $380.98 5933823500 $380.98 5933823600 $380.98 5933823700 $380.98 5933823800 $1,901.14 5933824000 $99.04 5933824100 $361.94 5933900100 $380.98 5933900200 $380.98 5933900300 $380.98 5933900400 $380.98 5933900500 $380.98 5933900600 $380.98 5933900700 $380.98 5933900800 $380.98 5933900900 $380.98 5933901000 $380.98 5933901100 $380.98 5933901200 $380.98 5933901300 $380.98 5933901400 $380.98 5933901500 $380.98 5933901600 $380.98 5933901700 $380.98 5933901800 $380.98 5933901900 $380.98 5933902000 $380.98 5933902100 $380.98 5933902200 $380.98 5933902300 $380.98 5933902400 $380.98 5933902500 $380.98 5933902600 $380.98 5933902700 $380.98 5933910100 $380.98 5933910200 $380.98 5933910300 $380.98 5933910400 $380.98 5933910500 $380.98 5933910600 $380.98 5933910700 $380.98 5933910800 $380.98 5933910900 $380.98 5933911000 $380.98 5933911100 $380.98 5933911200 $380.98 5933911300 $380.98 5933911400 $380.98 5933911500 $380.98 5933911600 $380.98 5933911700 $380.98 5933911800 $380.98 5933911900 $380.98 5933912000 $380.98 5933912100 $380.98 5933912200 $380.98 5933912300 $380.98 5933912400 $380.98 5933912500 $380.98 5933912600 $380.98 5933912700 $380.98 5933912800 $380.98 5933912900 $380.98 5933913000 $380.98 5933920100 $380.98 5933920400 $380.98 5933920500 $380.98 5933920600 $380.98 5933920700 $380.98 5933920800 $380.98 5933920900 $380.98 5933921000 $380.98 5933921100 $380.98 5933921200 $380.98 5933921600 $380.98 5933922000 $380.98 5934000100 $380.98 5934000200 $380.98 5934000300 $380.98 5934000400 $380.98 5934000500 $380.98 5934000600 $380.98 5934000700 $380.98 5934000800 $380.98 5934000900 $380.98 5934001000 $380.98 5934001100 $380.98 5934001200 $380.98 5934001300 $380.98 5934001400 $380.98 5934001500 $380.98 5934001600 $380.98 5934001700 $380.98 5934001800 $380.98 5934001900 $380.98 5934002000 $380.98 5934002100 $380.98 5934002200 $380.98 5934002300 $380.98 5934002400 $380.98 5934002500 $380.98 5934002600 $380.98 5934002700 $380.98 5934010100 $380.98 5934010200 $380.98 5934010300 $380.98 5934010400 $380.98 5934010500 $380.98 5934010600 $380.98 5934010700 $380.98 5934010800 $380.98 5934010900 $380.98 5934011000 $380.98 5934011100 $380.98 5934011200 $380.98 5934011300 $380.98 5934011400 $380.98 5934011500 $380.98 5934011600 $380.98 5934011700 $380.98 5934011800 $380.98 5934011900 $380.98 5934012000 $380.98 5934012100 $380.98 5934012200 $380.98 5934012300 $380.98 5934012400 $380.98 5934012500 $380.98 5934012600 $380.98 5934012700 $380.98 5934012800 $380.98 5934012900 $380.98 5934013000 $380.98 Page 122 of 189 City of Chula Vista Engineer's ReportPage 337 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-80 - OSD 20 Zone 6 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5934013100 $380.98 5934013200 $380.98 5934013300 $380.98 5934013400 $380.98 5934013500 $380.98 5934013600 $380.98 Totals Parcels 570 Levy $218,377.78 Page 123 of 189 City of Chula Vista Engineer's ReportPage 338 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6400902300 $5,644.10 6403400100 $235.16 6403400200 $235.16 6403400300 $235.16 6403400400 $235.16 6403400500 $235.16 6403400600 $235.16 6403400700 $235.16 6403400800 $235.16 6403400900 $235.16 6403401000 $235.16 6403401100 $235.16 6403401200 $235.16 6403401300 $235.16 6403401400 $235.16 6403401500 $235.16 6403401600 $235.16 6403401700 $235.16 6403401800 $235.16 6403401900 $235.16 6403402000 $235.16 6403402100 $235.16 6403402200 $235.16 6403402300 $235.16 6403402400 $235.16 6403402500 $235.16 6403402600 $235.16 6403402700 $235.16 6403402800 $235.16 6403402900 $235.16 6403403000 $235.16 6403403100 $235.16 6403403200 $235.16 6403403300 $235.16 6403403400 $235.16 6403403500 $235.16 6403403600 $235.16 6403403700 $235.16 6403403800 $235.16 6403403900 $235.16 6403404000 $235.16 6403404100 $235.16 6403404200 $235.16 6403404300 $235.16 6403404400 $235.16 6403404500 $235.16 6403404600 $235.16 6403404700 $235.16 6403404800 $235.16 6403404900 $235.16 6403405000 $235.16 6403405100 $235.16 6403405200 $235.16 6403405300 $235.16 6403405400 $235.16 6403405500 $235.16 6403405600 $235.16 6403405700 $235.16 6403405800 $235.16 6403405900 $235.16 6403406000 $235.16 6403406100 $235.16 6403406200 $235.16 6403406300 $235.16 6403406400 $235.16 6403406500 $235.16 6403406600 $235.16 6403406700 $235.16 6403406800 $235.16 6403406900 $235.16 6403407000 $235.16 6403407100 $235.16 6403407200 $235.16 6403407300 $235.16 6403407400 $235.16 6403407500 $235.16 6403407600 $235.16 6403407700 $235.16 6403407800 $235.16 6403407900 $235.16 6403408000 $235.16 6403408100 $235.16 6403408200 $235.16 6403408300 $235.16 6403408400 $235.16 6403408500 $235.16 6403500100 $235.16 6403500200 $235.16 6403500300 $235.16 6403500400 $235.16 6403500500 $235.16 6403500600 $235.16 6403500700 $235.16 6403500800 $235.16 6403500900 $235.16 6403501000 $235.16 6403501100 $235.16 6403501200 $235.16 6403501300 $235.16 6403501400 $235.16 6403501500 $235.16 6403501600 $235.16 6403501700 $235.16 6403501800 $235.16 6403501900 $235.16 6403502000 $235.16 6403502100 $235.16 6403502200 $235.16 6403502300 $235.16 6403502400 $235.16 6403502500 $235.16 6403502600 $235.16 6403502700 $235.16 6403502800 $235.16 6403502900 $235.16 6403503000 $235.16 6403503100 $235.16 6403503200 $235.16 6403503300 $235.16 6403503400 $235.16 6403503500 $235.16 6403503600 $235.16 6403503700 $235.16 6403503800 $235.16 6403503900 $235.16 6403504000 $235.16 6403504100 $235.16 6403504200 $235.16 6403504300 $235.16 6403504400 $235.16 6403504500 $235.16 6403504600 $235.16 6403504700 $235.16 6403504800 $235.16 6403504900 $235.16 6403505000 $235.16 6403505100 $235.16 6403505200 $235.16 6403505300 $235.16 6403505400 $235.16 6403505500 $235.16 Assessment Roll Page 124 of 189 City of Chula Vista Engineer's ReportPage 339 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403505600 $235.16 6403505700 $235.16 6403505800 $235.16 6403505900 $235.16 6403506000 $235.16 6403506100 $235.16 6403506200 $235.16 6403506300 $235.16 6403506400 $235.16 6403506500 $235.16 6403506600 $235.16 6403506700 $235.16 6403506800 $235.16 6403506900 $235.16 6403507000 $235.16 6403507100 $235.16 6403507200 $235.16 6403510100 $235.16 6403510200 $235.16 6403510300 $235.16 6403510400 $235.16 6403510500 $235.16 6403510600 $235.16 6403510700 $235.16 6403510800 $235.16 6403510900 $235.16 6403511000 $235.16 6403511100 $235.16 6403511200 $235.16 6403511300 $235.16 6403511400 $235.16 6403511500 $235.16 6403511600 $235.16 6403511700 $235.16 6403511800 $235.16 6403511900 $235.16 6403512000 $235.16 6403512100 $235.16 6403512200 $235.16 6403512300 $235.16 6403512400 $235.16 6403512500 $235.16 6403512600 $235.16 6403512700 $235.16 6403512800 $235.16 6403512900 $235.16 6403513000 $235.16 6403513100 $235.16 6403513200 $235.16 6403513300 $235.16 6403513400 $235.16 6403513500 $235.16 6403513600 $235.16 6403513700 $235.16 6403513800 $235.16 6403513900 $235.16 6403514000 $235.16 6403514100 $235.16 6403514200 $235.16 6403514300 $235.16 6403514400 $235.16 6403514500 $235.16 6403514600 $235.16 6403514700 $235.16 6403514800 $235.16 6403514900 $235.16 6403515000 $235.16 6403515100 $235.16 6403515200 $235.16 6403515300 $235.16 6403515400 $235.16 6403515500 $235.16 6403515600 $235.16 6403515700 $235.16 6403515800 $235.16 6403515900 $235.16 6403516000 $235.16 6403516100 $235.16 6403516200 $235.16 6403516300 $235.16 6403516400 $235.16 6403516500 $235.16 6403516600 $235.16 6403516700 $235.16 6403516800 $235.16 6403516900 $235.16 6403517000 $235.16 6403517100 $235.16 6403517200 $235.16 6403517300 $235.16 6403517400 $235.16 6403517500 $235.16 6403517600 $235.16 6403517700 $235.16 6403517800 $235.16 6403517900 $235.16 6403518000 $235.16 6403518100 $235.16 6403518200 $235.16 6403518300 $235.16 6403518400 $235.16 6403600100 $235.16 6403600200 $235.16 6403600300 $235.16 6403600400 $235.16 6403600500 $235.16 6403600600 $235.16 6403600700 $235.16 6403600800 $235.16 6403600900 $235.16 6403601000 $235.16 6403601100 $235.16 6403601200 $235.16 6403601300 $235.16 6403601400 $235.16 6403601500 $235.16 6403601600 $235.16 6403601700 $235.16 6403601800 $235.16 6403601900 $235.16 6403602000 $235.16 6403602100 $235.16 6403700100 $235.16 6403700200 $235.16 6403700300 $235.16 6403700400 $235.16 6403700500 $235.16 6403700600 $235.16 6403700700 $235.16 6403700800 $235.16 6403700900 $235.16 6403701000 $235.16 6403701100 $420.94 6403800100 $235.16 6403800200 $235.16 6403800300 $235.16 6403800400 $235.16 6403800500 $235.16 6403800600 $235.16 6403800700 $235.16 6403800800 $235.16 Page 125 of 189 City of Chula Vista Engineer's ReportPage 340 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403800900 $235.16 6403801000 $235.16 6403801100 $235.16 6403801200 $235.16 6403801300 $235.16 6403801400 $235.16 6403801500 $235.16 6403801600 $235.16 6403801700 $235.16 6403801800 $235.16 6403801900 $235.16 6403802000 $235.16 6403802100 $235.16 6403802200 $235.16 6403802300 $235.16 6403802400 $235.16 6403802500 $235.16 6403802600 $235.16 6403802700 $235.16 6403802800 $235.16 6403802900 $235.16 6403803000 $235.16 6403803100 $235.16 6403803200 $235.16 6403803300 $235.16 6403803400 $235.16 6403803500 $235.16 6403803600 $235.16 6403803700 $235.16 6403803800 $235.16 6403803900 $235.16 6403804000 $235.16 6403804100 $235.16 6403804200 $235.16 6403804300 $235.16 6403804400 $235.16 6403804500 $235.16 6403804600 $235.16 6403804700 $235.16 6403804800 $235.16 6403804900 $235.16 6403805000 $235.16 6403805100 $235.16 6403805200 $235.16 6403805300 $235.16 6403805400 $235.16 6403805500 $235.16 6403805600 $235.16 6403805700 $235.16 6403810100 $235.16 6403810200 $235.16 6403810300 $235.16 6403810400 $235.16 6403810500 $235.16 6403810600 $235.16 6403810700 $235.16 6403810800 $235.16 6403810900 $235.16 6403811000 $235.16 6403811100 $235.16 6403811200 $235.16 6403811300 $235.16 6403811400 $235.16 6403811500 $235.16 6403811600 $235.16 6403811700 $235.16 6403811800 $235.16 6403811900 $235.16 6403812000 $235.16 6403812100 $235.16 6403812200 $235.16 6403812300 $235.16 6403812400 $235.16 6403812500 $235.16 6403812600 $235.16 6403812700 $235.16 6403812800 $235.16 6403812900 $235.16 6403813000 $235.16 6403813100 $235.16 6403813200 $235.16 6403813300 $235.16 6403813400 $235.16 6403813900 $235.16 6403814000 $235.16 6403814100 $235.16 6403814200 $235.16 6403814300 $235.16 6403814400 $235.16 6403814500 $235.16 6403814600 $235.16 6403814700 $235.16 6403815100 $235.16 6403815200 $235.16 6403815300 $235.16 6403815400 $235.16 6403815500 $235.16 6403815600 $235.16 6403815700 $235.16 6403815800 $235.16 6403815900 $235.16 6403816000 $235.16 6403816100 $235.16 6403816200 $235.16 6403816300 $235.16 6403816400 $235.16 6403816500 $235.16 6403816600 $235.16 6403816700 $235.16 6403816800 $235.16 6403816900 $235.16 6403817000 $235.16 6403817100 $235.16 6403817200 $235.16 6403817300 $235.16 6403817400 $235.16 6403817500 $235.16 6403817600 $235.16 6403817700 $235.16 6403817800 $235.16 6403817900 $235.16 6403818000 $235.16 6403818100 $235.16 6403818200 $235.16 6403818300 $235.16 6403818400 $235.16 6403818500 $235.16 6403900100 $235.16 6403900200 $235.16 6403900300 $235.16 6403900400 $235.16 6403900500 $235.16 6403900600 $235.16 6403900700 $235.16 6403900800 $235.16 6403900900 $235.16 6403901000 $235.16 6403901100 $235.16 6403901200 $235.16 6403901300 $235.16 6403901400 $235.16 Page 126 of 189 City of Chula Vista Engineer's ReportPage 341 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6403901500 $235.16 6403901600 $235.16 6403901700 $235.16 6403901800 $235.16 6403901900 $235.16 6403902000 $235.16 6403910100 $235.16 6403910200 $235.16 6403910300 $235.16 6403910400 $235.16 6403910500 $235.16 6403910600 $235.16 6403910700 $235.16 6403910800 $235.16 6403910900 $235.16 6403911000 $235.16 6403911100 $235.16 6403911200 $235.16 6403911300 $235.16 6403911400 $235.16 6403911500 $235.16 6403911600 $235.16 6403911700 $235.16 6403911800 $235.16 6403911900 $235.16 6403912000 $235.16 6403912100 $235.16 6403912200 $235.16 6403912300 $235.16 6403912400 $235.16 6403912500 $235.16 6403912600 $235.16 6403912700 $235.16 6403912800 $235.16 6403912900 $235.16 6403913000 $235.16 6403913100 $235.16 6403913200 $235.16 6403913300 $235.16 6403913400 $235.16 6403913500 $235.16 6403913600 $235.16 6403913700 $235.16 6403913800 $235.16 6403913900 $235.16 6403914000 $235.16 6403914100 $235.16 6403914200 $235.16 6403920100 $235.16 6403920200 $235.16 6403920300 $235.16 6403920400 $235.16 6403920500 $235.16 6403920600 $235.16 6403920700 $235.16 6403920800 $235.16 6403920900 $235.16 6403921000 $235.16 6403921100 $235.16 6403921200 $235.16 6403921300 $235.16 6403921400 $235.16 6403921500 $235.16 6403921600 $235.16 6403921700 $235.16 6403921800 $235.16 6403921900 $235.16 6403922000 $235.16 6403922100 $235.16 6403922200 $235.16 6403922300 $235.16 6403922400 $235.16 6403922500 $235.16 6403922600 $235.16 6403922700 $235.16 6403922800 $235.16 6403922900 $235.16 6403923000 $235.16 6403923100 $235.16 6403923200 $235.16 6403923300 $235.16 6403923400 $235.16 6403923500 $235.16 6403923600 $235.16 6403923700 $235.16 6403923800 $235.16 6403923900 $235.16 6403924000 $235.16 6403924100 $235.16 6403924200 $235.16 6403924300 $235.16 6403924400 $235.16 6403924500 $235.16 6403924600 $235.16 6403924700 $235.16 6403924800 $235.16 6403924900 $235.16 6403925000 $235.16 6403925100 $235.16 6403925200 $235.16 6403925300 $235.16 6403925400 $235.16 6403925500 $235.16 6403925600 $235.16 6403925700 $235.16 6403925800 $235.16 6403925900 $235.16 6403926000 $235.16 6403926100 $235.16 6403926200 $235.16 6403926300 $235.16 6403926400 $235.16 6403926500 $235.16 6403926600 $235.16 6403926700 $235.16 6403926800 $235.16 6403926900 $235.16 6403927000 $235.16 6403927100 $235.16 6403927200 $235.16 6403927300 $235.16 6403927400 $235.16 6403927500 $235.16 6403927600 $235.16 6403927700 $235.16 6403927800 $235.16 6403927900 $235.16 6403928000 $235.16 6404000100 $188.12 6404000200 $188.12 6404000300 $188.12 6404000400 $188.12 6404000500 $188.12 6404000600 $188.12 6404000700 $188.12 6404000800 $188.12 6404000900 $188.12 6404001000 $188.12 6404001100 $188.12 6404001200 $188.12 6404001300 $188.12 Page 127 of 189 City of Chula Vista Engineer's ReportPage 342 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404001400 $188.12 6404001500 $188.12 6404001600 $188.12 6404001700 $188.12 6404001800 $188.12 6404001900 $188.12 6404002000 $188.12 6404002100 $188.12 6404002200 $188.12 6404002300 $188.12 6404002400 $188.12 6404002500 $188.12 6404002600 $188.12 6404002700 $188.12 6404002800 $188.12 6404002900 $188.12 6404003000 $188.12 6404003100 $188.12 6404003200 $188.12 6404003300 $188.12 6404003400 $188.12 6404003500 $188.12 6404003600 $188.12 6404003700 $188.12 6404003800 $188.12 6404003900 $188.12 6404004000 $188.12 6404004100 $188.12 6404004200 $188.12 6404004300 $188.12 6404004400 $188.12 6404004500 $188.12 6404004600 $188.12 6404004700 $188.12 6404004800 $188.12 6404004900 $188.12 6404005000 $188.12 6404005100 $188.12 6404005200 $188.12 6404005300 $188.12 6404005400 $188.12 6404005500 $188.12 6404005600 $188.12 6404005700 $188.12 6404005800 $188.12 6404005900 $188.12 6404006000 $188.12 6404006100 $188.12 6404006200 $188.12 6404006300 $188.12 6404006400 $188.12 6404006500 $188.12 6404006600 $188.12 6404006700 $188.12 6404006800 $188.12 6404010100 $188.12 6404010200 $188.12 6404010300 $188.12 6404010400 $188.12 6404010500 $188.12 6404010600 $188.12 6404010700 $188.12 6404010800 $188.12 6404010900 $188.12 6404011000 $188.12 6404011100 $188.12 6404011200 $188.12 6404011300 $188.12 6404011400 $188.12 6404011500 $188.12 6404011600 $188.12 6404011700 $188.12 6404011800 $188.12 6404011900 $188.12 6404012000 $188.12 6404012100 $188.12 6404012200 $188.12 6404012300 $188.12 6404012400 $188.12 6404012500 $188.12 6404012600 $188.12 6404012700 $188.12 6404012800 $188.12 6404012900 $188.12 6404013000 $188.12 6404013100 $188.12 6404013200 $188.12 6404013300 $188.12 6404013400 $188.12 6404013500 $188.12 6404013600 $188.12 6404013700 $188.12 6404013800 $188.12 6404013900 $188.12 6404014000 $188.12 6404014100 $188.12 6404014200 $188.12 6404014300 $188.12 6404014400 $188.12 6404014500 $188.12 6404014600 $188.12 6404014700 $188.12 6404014800 $188.12 6404014900 $188.12 6404015000 $188.12 6404015100 $188.12 6404015200 $188.12 6404100100 $235.16 6404100200 $235.16 6404100300 $235.16 6404100400 $235.16 6404100500 $235.16 6404100600 $235.16 6404100700 $235.16 6404100800 $235.16 6404100900 $235.16 6404101000 $235.16 6404101100 $235.16 6404101200 $235.16 6404101300 $235.16 6404101400 $235.16 6404101500 $235.16 6404101600 $235.16 6404101700 $235.16 6404101800 $235.16 6404101900 $235.16 6404102000 $235.16 6404102100 $235.16 6404102200 $235.16 6404102300 $235.16 6404102400 $235.16 6404102500 $235.16 6404102600 $235.16 6404102700 $235.16 6404102800 $235.16 6404102900 $235.16 6404103000 $235.16 6404103100 $235.16 6404103200 $235.16 6404103300 $235.16 6404103400 $235.16 Page 128 of 189 City of Chula Vista Engineer's ReportPage 343 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404103500 $235.16 6404103600 $235.16 6404103700 $235.16 6404103800 $235.16 6404103900 $235.16 6404104000 $235.16 6404104100 $235.16 6404104200 $235.16 6404104300 $235.16 6404104400 $235.16 6404104500 $235.16 6404104600 $235.16 6404104700 $235.16 6404104800 $235.16 6404104900 $235.16 6404105000 $235.16 6404105100 $235.16 6404110100 $235.16 6404110200 $235.16 6404110300 $235.16 6404110400 $235.16 6404110500 $235.16 6404110600 $235.16 6404110700 $235.16 6404110800 $235.16 6404110900 $235.16 6404111000 $235.16 6404111100 $235.16 6404111200 $235.16 6404111300 $235.16 6404111400 $235.16 6404111500 $235.16 6404111600 $235.16 6404111700 $235.16 6404111800 $235.16 6404111900 $235.16 6404112000 $235.16 6404112100 $235.16 6404112200 $235.16 6404112300 $235.16 6404112400 $235.16 6404112500 $235.16 6404112600 $235.16 6404112700 $235.16 6404112800 $235.16 6404112900 $235.16 6404113000 $235.16 6404113100 $235.16 6404113200 $235.16 6404113300 $235.16 6404113400 $235.16 6404113500 $235.16 6404113600 $235.16 6404113700 $235.16 6404113800 $235.16 6404113900 $235.16 6404114000 $235.16 6404114100 $235.16 6404114200 $235.16 6404114300 $235.16 6404114400 $235.16 6404114500 $235.16 6404114600 $235.16 6404114700 $235.16 6404114800 $235.16 6404114900 $235.16 6404115000 $235.16 6404115100 $235.16 6404115200 $235.16 6404115300 $235.16 6404115400 $235.16 6404115500 $235.16 6404115600 $235.16 6404115700 $235.16 6404115800 $235.16 6404115900 $235.16 6404116000 $235.16 6404116100 $235.16 6404116200 $235.16 6404116300 $235.16 6404116400 $235.16 6404116500 $235.16 6404116600 $235.16 6404116700 $235.16 6404116800 $235.16 6404116900 $235.16 6404117000 $235.16 6404117100 $235.16 6404117200 $235.16 6404117300 $235.16 6404117400 $235.16 6404117500 $235.16 6404117600 $235.16 6404117700 $235.16 6404117800 $235.16 6404117900 $235.16 6404118000 $235.16 6404118100 $235.16 6404200100 $235.16 6404200200 $235.16 6404200300 $235.16 6404200400 $235.16 6404200500 $235.16 6404200600 $235.16 6404200700 $235.16 6404200800 $235.16 6404200900 $235.16 6404201000 $235.16 6404201100 $235.16 6404201200 $235.16 6404201300 $235.16 6404201400 $235.16 6404201500 $235.16 6404201600 $235.16 6404201700 $235.16 6404201800 $235.16 6404201900 $235.16 6404202000 $235.16 6404202100 $235.16 6404202200 $235.16 6404202300 $235.16 6404202400 $235.16 6404202500 $235.16 6404202600 $235.16 6404202700 $235.16 6404202800 $235.16 6404202900 $235.16 6404203000 $235.16 6404203100 $235.16 6404203200 $235.16 6404203300 $235.16 6404203400 $235.16 6404203500 $235.16 6404203600 $235.16 6404203700 $235.16 6404203800 $235.16 6404203900 $235.16 6404204000 $235.16 6404204100 $235.16 6404204200 $235.16 6404204300 $235.16 Page 129 of 189 City of Chula Vista Engineer's ReportPage 344 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404204400 $235.16 6404204500 $235.16 6404204600 $235.16 6404204700 $235.16 6404204800 $235.16 6404204900 $235.16 6404205000 $235.16 6404205100 $235.16 6404205200 $235.16 6404205300 $235.16 6404205400 $235.16 6404205500 $235.16 6404205600 $235.16 6404205700 $235.16 6404205800 $235.16 6404205900 $235.16 6404206000 $235.16 6404206100 $235.16 6404206200 $235.16 6404206300 $235.16 6404210100 $235.16 6404210200 $235.16 6404210300 $235.16 6404210400 $235.16 6404210500 $235.16 6404210600 $235.16 6404210700 $235.16 6404210800 $235.16 6404210900 $235.16 6404211000 $235.16 6404211100 $235.16 6404211200 $235.16 6404211300 $235.16 6404211400 $235.16 6404211500 $235.16 6404211600 $235.16 6404211700 $235.16 6404211800 $235.16 6404211900 $235.16 6404212000 $235.16 6404212100 $235.16 6404212200 $235.16 6404212300 $235.16 6404212400 $235.16 6404212500 $235.16 6404212600 $235.16 6404212700 $235.16 6404212800 $235.16 6404212900 $235.16 6404213000 $235.16 6404213100 $235.16 6404213200 $235.16 6404213300 $235.16 6404213400 $235.16 6404213500 $235.16 6404213600 $235.16 6404213700 $235.16 6404213800 $235.16 6404213900 $235.16 6404214000 $235.16 6404214100 $235.16 6404214200 $235.16 6404214300 $235.16 6404214400 $235.16 6404214500 $235.16 6404214600 $235.16 6404214700 $235.16 6404214800 $235.16 6404214900 $235.16 6404215000 $235.16 6404215100 $235.16 6404215200 $235.16 6404215300 $235.16 6404215400 $235.16 6404215500 $235.16 6404215600 $235.16 6404215700 $235.16 6404215800 $235.16 6404215900 $235.16 6404216000 $235.16 6404216100 $235.16 6404216200 $235.16 6404216300 $235.16 6404216400 $235.16 6404216500 $235.16 6404216600 $235.16 6404216700 $235.16 6404216800 $235.16 6404216900 $235.16 6404217000 $235.16 6404217100 $235.16 6404217200 $235.16 6404217300 $235.16 6404217400 $235.16 6404217500 $235.16 6404217600 $235.16 6404217700 $235.16 6404217800 $235.16 6404217900 $235.16 6404218000 $235.16 6404218100 $235.16 6404218200 $235.16 6404218300 $235.16 6404218400 $235.16 6404218500 $235.16 6404218600 $235.16 6404218700 $235.16 6404218800 $235.16 6404300401 $188.12 6404300402 $188.12 6404300403 $188.12 6404300404 $188.12 6404300405 $188.12 6404300406 $188.12 6404300407 $188.12 6404300408 $188.12 6404300409 $188.12 6404300410 $188.12 6404300411 $188.12 6404300412 $188.12 6404300413 $188.12 6404300414 $188.12 6404300415 $188.12 6404300416 $188.12 6404300417 $188.12 6404300418 $188.12 6404300419 $188.12 6404300420 $188.12 6404300421 $188.12 6404300501 $188.12 6404300502 $188.12 6404300503 $188.12 6404300504 $188.12 6404300505 $188.12 6404300506 $188.12 6404300507 $188.12 6404300508 $188.12 6404300509 $188.12 6404300510 $188.12 6404300511 $188.12 6404300512 $188.12 Page 130 of 189 City of Chula Vista Engineer's ReportPage 345 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404300513 $188.12 6404300514 $188.12 6404300515 $188.12 6404300516 $188.12 6404300517 $188.12 6404300518 $188.12 6404300519 $188.12 6404300520 $188.12 6404300521 $188.12 6404300701 $188.12 6404300702 $188.12 6404300703 $188.12 6404300704 $188.12 6404300705 $188.12 6404300706 $188.12 6404300707 $188.12 6404300708 $188.12 6404300709 $188.12 6404300710 $188.12 6404300711 $188.12 6404300712 $188.12 6404300713 $188.12 6404300714 $188.12 6404300715 $188.12 6404300716 $188.12 6404300717 $188.12 6404300718 $188.12 6404300719 $188.12 6404300720 $188.12 6404300721 $188.12 6404300722 $188.12 6404300723 $188.12 6404300724 $188.12 6404300801 $188.12 6404300802 $188.12 6404300803 $188.12 6404300804 $188.12 6404300805 $188.12 6404300806 $188.12 6404300807 $188.12 6404300808 $188.12 6404300809 $188.12 6404300810 $188.12 6404300811 $188.12 6404300812 $188.12 6404300813 $188.12 6404300814 $188.12 6404300815 $188.12 6404300816 $188.12 6404300817 $188.12 6404300818 $188.12 6404301001 $188.12 6404301002 $188.12 6404301003 $188.12 6404301004 $188.12 6404301005 $188.12 6404301006 $188.12 6404301007 $188.12 6404301008 $188.12 6404301009 $188.12 6404301010 $188.12 6404301011 $188.12 6404301012 $188.12 6404301013 $188.12 6404301014 $188.12 6404301015 $188.12 6404301016 $188.12 6404301017 $188.12 6404301018 $188.12 6404301201 $188.12 6404301202 $188.12 6404301203 $188.12 6404301204 $188.12 6404301205 $188.12 6404301206 $188.12 6404301207 $188.12 6404301208 $188.12 6404301209 $188.12 6404301210 $188.12 6404301211 $188.12 6404301212 $188.12 6404301213 $188.12 6404301214 $188.12 6404301215 $188.12 6404301216 $188.12 6404301217 $188.12 6404301218 $188.12 6404301301 $188.12 6404301302 $188.12 6404301303 $188.12 6404301304 $188.12 6404301305 $188.12 6404301306 $188.12 6404301307 $188.12 6404301308 $188.12 6404301309 $188.12 6404301310 $188.12 6404301311 $188.12 6404301312 $188.12 6404301313 $188.12 6404301314 $188.12 6404301315 $188.12 6404301316 $188.12 6404301317 $188.12 6404301318 $188.12 6404301319 $188.12 6404301320 $188.12 6404301321 $188.12 6404301401 $188.12 6404301402 $188.12 6404301403 $188.12 6404301404 $188.12 6404301405 $188.12 6404301406 $188.12 6404301407 $188.12 6404301408 $188.12 6404301409 $188.12 6404301410 $188.12 6404301411 $188.12 6404301412 $188.12 6404301413 $188.12 6404301414 $188.12 6404301415 $188.12 6404301416 $188.12 6404301417 $188.12 6404301418 $188.12 6404301501 $188.12 6404301502 $188.12 6404301503 $188.12 6404301504 $188.12 6404301505 $188.12 6404301506 $188.12 6404301507 $188.12 6404301508 $188.12 6404301509 $188.12 6404301510 $188.12 6404301511 $188.12 6404301512 $188.12 6404301513 $188.12 6404301514 $188.12 6404301515 $188.12 Page 131 of 189 City of Chula Vista Engineer's ReportPage 346 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-81 - OSD 20 Zone 7 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404301516 $188.12 6404301517 $188.12 6404301518 $188.12 6404400101 $188.12 6404400102 $188.12 6404400103 $188.12 6404400104 $188.12 6404400105 $188.12 6404400106 $188.12 6404400107 $188.12 6404400108 $188.12 6404400109 $188.12 6404400110 $188.12 6404400111 $188.12 6404400112 $188.12 6404400113 $188.12 6404400114 $188.12 6404400115 $188.12 6404400116 $188.12 6404400117 $188.12 6404400118 $188.12 6404400119 $188.12 6404400120 $188.12 6404400121 $188.12 6404400201 $188.12 6404400202 $188.12 6404400203 $188.12 6404400204 $188.12 6404400205 $188.12 6404400206 $188.12 6404400207 $188.12 6404400208 $188.12 6404400209 $188.12 6404400210 $188.12 6404400211 $188.12 6404400212 $188.12 6404400213 $188.12 6404400214 $188.12 6404400215 $188.12 6404400216 $188.12 6404400217 $188.12 6404400218 $188.12 6404400401 $188.12 6404400402 $188.12 6404400403 $188.12 6404400404 $188.12 6404400405 $188.12 6404400406 $188.12 6404400407 $188.12 6404400408 $188.12 6404400409 $188.12 6404400410 $188.12 6404400411 $188.12 6404400412 $188.12 6404400413 $188.12 6404400414 $188.12 6404400415 $188.12 6404400416 $188.12 6404400417 $188.12 6404400418 $188.12 6404400501 $188.12 6404400502 $188.12 6404400503 $188.12 6404400504 $188.12 6404400505 $188.12 6404400506 $188.12 6420110300 $235.16 6420110400 $235.16 6420110500 $235.16 6420110600 $235.16 6420110700 $235.16 6420110800 $235.16 6420110900 $235.16 6420111000 $235.16 6420111100 $235.16 6420111200 $235.16 6420111300 $235.16 6420111400 $235.16 6420111500 $235.16 6420111600 $235.16 6420111700 $235.16 6420111800 $235.16 6420111900 $235.16 6420112000 $235.16 6420112100 $235.16 6420112200 $235.16 6420112300 $235.16 6420112400 $235.16 6420112500 $235.16 Totals Parcels 1,217 Levy $274,850.04 Page 132 of 189 City of Chula Vista Engineer's ReportPage 347 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-82 - OSD 20 Zone 8 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5933600100 $54.20 5933600200 $54.20 5933601800 $54.20 5933601900 $54.20 5933602000 $54.20 5933602100 $54.20 5933602200 $54.20 5933602300 $54.20 5933602400 $54.20 5933602500 $54.20 5933602600 $54.20 5933602700 $54.20 5933602800 $54.20 5933602900 $54.20 5933603000 $54.20 5933603100 $54.20 5933620200 $54.20 5933620300 $54.20 5933620400 $54.20 5933620500 $54.20 5933620600 $54.20 5933620700 $54.20 5933620800 $54.20 5933620900 $54.20 5933621000 $54.20 5933621100 $54.20 5933723700 $17.88 5933723800 $17.88 5933723900 $17.88 5933724000 $17.88 5933724100 $17.88 5933724200 $17.88 5933724300 $17.88 5933724400 $17.88 5933724500 $17.88 5933724600 $17.88 5933724700 $17.88 5933724800 $17.88 5933724900 $17.88 5933725000 $17.88 5933725100 $17.88 5933725200 $17.88 5933725300 $17.88 5933725400 $17.88 5933725500 $17.88 5933725600 $17.88 5933735900 $17.88 5933736000 $17.88 5933736100 $17.88 5933800100 $17.88 5933800200 $17.88 5933800300 $17.88 5933800400 $17.88 5933800500 $17.88 5933800600 $17.88 5933800700 $17.88 5933800800 $17.88 5933800900 $17.88 5933801000 $17.88 5933801100 $17.88 5933801200 $17.88 5933801300 $17.88 5933801400 $17.88 5933801500 $17.88 5933801600 $17.88 5933801700 $17.88 5933801800 $17.88 5933801900 $17.88 5933802000 $17.88 5933802100 $17.88 5933802200 $17.88 5933802300 $17.88 5933802400 $17.88 5933803000 $17.88 5933803100 $17.88 5933803200 $17.88 5933803300 $17.88 5933810100 $17.88 5933810200 $17.88 5933810300 $17.88 5933900100 $54.20 5933900200 $54.20 5933900300 $54.20 5933900400 $54.20 5933900500 $54.20 5933900600 $54.20 5933900700 $54.20 5933900800 $54.20 5933900900 $54.20 5933901000 $54.20 5933901100 $54.20 5933901200 $54.20 5933901300 $54.20 5933901400 $54.20 5933901500 $54.20 5933901600 $54.20 5933901700 $54.20 5933901800 $54.20 5933901900 $54.20 5933902000 $54.20 5933902100 $54.20 5933902200 $54.20 5933902300 $54.20 5933902400 $54.20 5933902500 $54.20 5933902600 $54.20 5933902700 $54.20 5933910100 $54.20 5933910200 $54.20 5933910300 $54.20 5933910400 $54.20 5933910500 $54.20 5933910600 $54.20 5933910700 $54.20 5933910800 $54.20 5933910900 $54.20 5933911000 $54.20 5933911100 $54.20 5933911200 $54.20 5933913000 $54.20 5933920400 $54.20 5933920500 $54.20 5933920600 $54.20 5933920700 $54.20 5933920800 $54.20 5933920900 $54.20 5933921000 $54.20 5933921100 $54.20 5933921200 $54.20 5934000500 $54.20 5934000600 $54.20 5934000700 $54.20 5934000800 $54.20 5934002000 $54.20 5934002100 $54.20 5934002200 $54.20 5934002300 $54.20 5934002400 $54.20 5934002500 $54.20 5934002600 $54.20 5934002700 $54.20 Assessment Roll Page 133 of 189 City of Chula Vista Engineer's ReportPage 348 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-82 - OSD 20 Zone 8 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5934010200 $54.20 5934010300 $54.20 5934010400 $54.20 5934010500 $54.20 5934010600 $54.20 5934010700 $54.20 5934010800 $54.20 5934010900 $54.20 5934011000 $54.20 5934011100 $54.20 5934011200 $54.20 5934011300 $54.20 5934011400 $54.20 5934011500 $54.20 Totals Parcels 155 Levy $6,439.72 Page 134 of 189 City of Chula Vista Engineer's ReportPage 349 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-83 - OSD 20 Zone 9 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6400902300 $86.08 6403402000 $6.02 6403402100 $6.02 6403402200 $6.02 6403402300 $6.02 6403402400 $6.02 6403402500 $6.02 6403402600 $6.02 6403402700 $6.02 6403402800 $6.02 6403402900 $6.02 6403403000 $6.02 6403403100 $6.02 6403403200 $6.02 6403403300 $6.02 6403403400 $6.02 6403403500 $6.02 6403403600 $6.02 6403403700 $6.02 6403403800 $6.02 6403403900 $6.02 6403404000 $6.02 6403404100 $6.02 6403404200 $6.02 6403404300 $6.02 6403404400 $6.02 6403404500 $6.02 6403404600 $6.02 6403404700 $6.02 6403404800 $6.02 6403404900 $6.02 6403405000 $6.02 6403405100 $6.02 6403405200 $6.02 6403406500 $6.02 6403406600 $6.02 6403406700 $6.02 6403406800 $6.02 6403406900 $6.02 6403407000 $6.02 6403407100 $6.02 6403407200 $6.02 6403407300 $6.02 6403407400 $6.02 6403407500 $6.02 6403407600 $6.02 6403407700 $6.02 6403407800 $6.02 6403407900 $6.02 6403408000 $6.02 6403408100 $6.02 6403408200 $6.02 6403408300 $6.02 6403408400 $6.02 6403408500 $6.02 6403513300 $6.02 6403513400 $6.02 6403513500 $6.02 6403513600 $6.02 6403513700 $6.02 6403513800 $6.02 6403513900 $6.02 6403514000 $6.02 6403514100 $6.02 6403514200 $6.02 6403514300 $6.02 6403514400 $6.02 6403514500 $6.02 6403514600 $6.02 6403514700 $6.02 6403514800 $6.02 6403514900 $6.02 6403515000 $6.02 6403515100 $6.02 6403515200 $6.02 6403515300 $6.02 6403515400 $6.02 6403515500 $6.02 6403515600 $6.02 6403515700 $6.02 6403515800 $6.02 6403515900 $6.02 6403516000 $6.02 6403516100 $6.02 6403516200 $6.02 6403516300 $6.02 6403516400 $6.02 6403516500 $6.02 6403516600 $6.02 6403600100 $8.60 6403600200 $8.60 6403600300 $8.60 6403600400 $8.60 6403600500 $8.60 6403600600 $8.60 6403600700 $8.60 6403600800 $8.60 6403600900 $8.60 6403601000 $8.60 6403601100 $8.60 6403601200 $8.60 6403601300 $8.60 6403601400 $8.60 6403601500 $8.60 6403601600 $8.60 6403601700 $8.60 6403601800 $8.60 6403601900 $8.60 6403602000 $8.60 6403602100 $8.60 6403700100 $8.60 6403700200 $8.60 6403700300 $8.60 6403700400 $8.60 6403700500 $8.60 6403700600 $8.60 6403700700 $8.60 6403700800 $8.60 6403700900 $8.60 6403701000 $8.60 6403701100 $89.94 6403813900 $8.60 6403814000 $8.60 6403814100 $8.60 6403814200 $8.60 6403925600 $8.60 6403925700 $8.60 6403925800 $8.60 6403925900 $8.60 6403926000 $8.60 6403926100 $8.60 6403926200 $8.60 6403926300 $8.60 6403926400 $8.60 6403926500 $8.60 6403926600 $8.60 6403926700 $8.60 6403926800 $8.60 6404300401 $4.30 6404300402 $4.30 6404300403 $4.30 Assessment Roll Page 135 of 189 City of Chula Vista Engineer's ReportPage 350 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-83 - OSD 20 Zone 9 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404300404 $4.30 6404300405 $4.30 6404300406 $4.30 6404300407 $4.30 6404300408 $4.30 6404300409 $4.30 6404300410 $4.30 6404300411 $4.30 6404300412 $4.30 6404300413 $4.30 6404300414 $4.30 6404300415 $4.30 6404300416 $4.30 6404300417 $4.30 6404300418 $4.30 6404300419 $4.30 6404300420 $4.30 6404300421 $4.30 6404300501 $4.30 6404300502 $4.30 6404300503 $4.30 6404300504 $4.30 6404300505 $4.30 6404300506 $4.30 6404300507 $4.30 6404300508 $4.30 6404300509 $4.30 6404300510 $4.30 6404300511 $4.30 6404300512 $4.30 6404300513 $4.30 6404300514 $4.30 6404300515 $4.30 6404300516 $4.30 6404300517 $4.30 6404300518 $4.30 6404300519 $4.30 6404300520 $4.30 6404300521 $4.30 6404300701 $4.30 6404300702 $4.30 6404300703 $4.30 6404300704 $4.30 6404300705 $4.30 6404300706 $4.30 6404300707 $4.30 6404300708 $4.30 6404300709 $4.30 6404300710 $4.30 6404300711 $4.30 6404300712 $4.30 6404300713 $4.30 6404300714 $4.30 6404300715 $4.30 6404300716 $4.30 6404300717 $4.30 6404300718 $4.30 6404300719 $4.30 6404300720 $4.30 6404300721 $4.30 6404300722 $4.30 6404300723 $4.30 6404300724 $4.30 6404300801 $4.30 6404300802 $4.30 6404300803 $4.30 6404300804 $4.30 6404300805 $4.30 6404300806 $4.30 6404300807 $4.30 6404300808 $4.30 6404300809 $4.30 6404300810 $4.30 6404300811 $4.30 6404300812 $4.30 6404300813 $4.30 6404300814 $4.30 6404300815 $4.30 6404300816 $4.30 6404300817 $4.30 6404300818 $4.30 6404301001 $4.30 6404301002 $4.30 6404301003 $4.30 6404301004 $4.30 6404301005 $4.30 6404301006 $4.30 6404301007 $4.30 6404301008 $4.30 6404301009 $4.30 6404301010 $4.30 6404301011 $4.30 6404301012 $4.30 6404301013 $4.30 6404301014 $4.30 6404301015 $4.30 6404301016 $4.30 6404301017 $4.30 6404301018 $4.30 6404301201 $4.30 6404301202 $4.30 6404301203 $4.30 6404301204 $4.30 6404301205 $4.30 6404301206 $4.30 6404301207 $4.30 6404301208 $4.30 6404301209 $4.30 6404301210 $4.30 6404301211 $4.30 6404301212 $4.30 6404301213 $4.30 6404301214 $4.30 6404301215 $4.30 6404301216 $4.30 6404301217 $4.30 6404301218 $4.30 6404301301 $4.30 6404301302 $4.30 6404301303 $4.30 6404301304 $4.30 6404301305 $4.30 6404301306 $4.30 6404301307 $4.30 6404301308 $4.30 6404301309 $4.30 6404301310 $4.30 6404301311 $4.30 6404301312 $4.30 6404301313 $4.30 6404301314 $4.30 6404301315 $4.30 6404301316 $4.30 6404301317 $4.30 6404301318 $4.30 6404301319 $4.30 6404301320 $4.30 6404301321 $4.30 6404301401 $4.30 6404301402 $4.30 6404301403 $4.30 Page 136 of 189 City of Chula Vista Engineer's ReportPage 351 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-83 - OSD 20 Zone 9 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6404301404 $4.30 6404301405 $4.30 6404301406 $4.30 6404301407 $4.30 6404301408 $4.30 6404301409 $4.30 6404301410 $4.30 6404301411 $4.30 6404301412 $4.30 6404301413 $4.30 6404301414 $4.30 6404301415 $4.30 6404301416 $4.30 6404301417 $4.30 6404301418 $4.30 6404301501 $4.30 6404301502 $4.30 6404301503 $4.30 6404301504 $4.30 6404301505 $4.30 6404301506 $4.30 6404301507 $4.30 6404301508 $4.30 6404301509 $4.30 6404301510 $4.30 6404301511 $4.30 6404301512 $4.30 6404301513 $4.30 6404301514 $4.30 6404301515 $4.30 6404301516 $4.30 6404301517 $4.30 6404301518 $4.30 6404400101 $4.30 6404400102 $4.30 6404400103 $4.30 6404400104 $4.30 6404400105 $4.30 6404400106 $4.30 6404400107 $4.30 6404400108 $4.30 6404400109 $4.30 6404400110 $4.30 6404400111 $4.30 6404400112 $4.30 6404400113 $4.30 6404400114 $4.30 6404400115 $4.30 6404400116 $4.30 6404400117 $4.30 6404400118 $4.30 6404400119 $4.30 6404400120 $4.30 6404400121 $4.30 6404400201 $4.30 6404400202 $4.30 6404400203 $4.30 6404400204 $4.30 6404400205 $4.30 6404400206 $4.30 6404400207 $4.30 6404400208 $4.30 6404400209 $4.30 6404400210 $4.30 6404400211 $4.30 6404400212 $4.30 6404400213 $4.30 6404400214 $4.30 6404400215 $4.30 6404400216 $4.30 6404400217 $4.30 6404400218 $4.30 6404400401 $4.30 6404400402 $4.30 6404400403 $4.30 6404400404 $4.30 6404400405 $4.30 6404400406 $4.30 6404400407 $4.30 6404400408 $4.30 6404400409 $4.30 6404400410 $4.30 6404400411 $4.30 6404400412 $4.30 6404400413 $4.30 6404400414 $4.30 6404400415 $4.30 6404400416 $4.30 6404400417 $4.30 6404400418 $4.30 6404400501 $4.30 6404400502 $4.30 6404400503 $4.30 6404400504 $4.30 6404400505 $4.30 6404400506 $4.30 Totals Parcels 378 Levy $2,150.58 Page 137 of 189 City of Chula Vista Engineer's ReportPage 352 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-30 - OSD 23 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6450201300 $13,285.04 6450201700 $17,763.14 6450210100 $661.04 6450210200 $1,492.70 6450210300 $2,430.96 6450213400 $570.42 6450213500 $527.76 6450214700 $17,405.96 6450221100 $7,159.64 Totals Parcels 9 Levy $61,296.66 Assessment Roll Page 138 of 189 City of Chula Vista Engineer's ReportPage 353 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-31 - OSD 24 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5953100100 $904.70 5953100200 $904.70 5953100300 $904.70 5953100400 $904.70 5953100500 $904.70 5953100600 $904.70 5953100700 $904.70 5953100800 $904.70 5953100900 $904.70 5953101000 $904.70 5953101100 $904.70 5953101200 $904.70 5953101300 $904.70 5953101400 $904.70 5953101500 $904.70 5953101600 $904.70 5953101700 $904.70 5953101800 $904.70 5953110100 $904.70 5953110200 $904.70 5953110300 $904.70 5953110400 $904.70 5953110500 $904.70 5953110600 $904.70 5953110700 $904.70 5953110800 $904.70 5953110900 $904.70 5953111000 $904.70 5953111100 $904.70 5953111200 $904.70 5953111300 $904.70 5953111400 $904.70 5953111500 $904.70 5953111600 $904.70 5953111700 $904.70 5953111800 $904.70 5953111900 $904.70 5953112000 $904.70 5953112100 $904.70 5953112200 $904.70 Totals Parcels 40 Levy $36,188.00 Assessment Roll Page 139 of 189 City of Chula Vista Engineer's ReportPage 354 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-38 - OSD 26 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5703800100 $710.04 5703800500 $710.04 5703800600 $710.04 5703800700 $710.04 5703800800 $710.04 5703801100 $710.04 5703801300 $710.04 5703801400 $710.04 5703801500 $710.04 5703801600 $710.04 5703801700 $710.04 5703801800 $710.04 5703801900 $710.04 5703802300 $710.04 5703802400 $710.04 5703802500 $710.04 5703802600 $710.04 5703803100 $710.04 5703803200 $710.04 Totals Parcels 19 Levy $13,490.76 Assessment Roll Page 140 of 189 City of Chula Vista Engineer's ReportPage 355 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-40 - OSD 31 Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5954500100 $580.00 5954500200 $580.00 5954500300 $580.00 5954500400 $580.00 5954500500 $580.00 5954500600 $580.00 5954500700 $580.00 5954500800 $580.00 5954501400 $580.00 5954501500 $580.00 5954502100 $580.00 5954502200 $580.00 5954502300 $580.00 5954502400 $580.00 5954502500 $580.00 5954502600 $580.00 5954502700 $580.00 5954502800 $580.00 5954502900 $580.00 5954503000 $580.00 5954503100 $580.00 5954503200 $580.00 5954503300 $580.00 5954503400 $580.00 5954503500 $580.00 5954503600 $580.00 5954503700 $580.00 5954503800 $580.00 5954504100 $580.00 5954504200 $580.00 5954504300 $580.00 5954504400 $580.00 5954504500 $580.00 5954504600 $580.00 5954504700 $580.00 5954504800 $580.00 5954504900 $580.00 5954505000 $580.00 5954505200 $580.00 5954505300 $580.00 5954505400 $580.00 5954505500 $580.00 5954505600 $580.00 5954505700 $580.00 5954505800 $580.00 5954505900 $580.00 5954506000 $580.00 5954506100 $580.00 5954506200 $580.00 5954506300 $580.00 5954506400 $580.00 5954506500 $580.00 5954506600 $580.00 5954506700 $580.00 5954506800 $580.00 5954506900 $580.00 5954507000 $580.00 5954507100 $580.00 5954507200 $580.00 5954507300 $580.00 5954507400 $580.00 5954507500 $580.00 5954507600 $580.00 5954507700 $580.00 5954507800 $580.00 5954507900 $580.00 5954508000 $580.00 5954508100 $580.00 5954508200 $580.00 5954508300 $580.00 5954508400 $580.00 5954508500 $580.00 5954508600 $580.00 5954508700 $580.00 5954508800 $580.00 5954508900 $580.00 5954509000 $580.00 5954510100 $580.00 5954510200 $580.00 5954510300 $580.00 5954510400 $580.00 5954510500 $580.00 5954510600 $580.00 5954510700 $580.00 5954510800 $580.00 5954510900 $580.00 5954511000 $580.00 5954511100 $580.00 5954511200 $580.00 5954511300 $580.00 5954511400 $580.00 5954511500 $580.00 5954511600 $580.00 5954511700 $580.00 5954511800 $580.00 5954511900 $580.00 5954512200 $580.00 5954512300 $580.00 5954512400 $580.00 5954512500 $580.00 5954512600 $580.00 5954512700 $580.00 5954512800 $580.00 5954512900 $580.00 5954513000 $580.00 5954513100 $580.00 5954513200 $580.00 5954513300 $580.00 5954513400 $580.00 5954600300 $580.00 5954600400 $580.00 5954600600 $580.00 5954600700 $580.00 5954600800 $580.00 5954600900 $580.00 5954601000 $580.00 5954601100 $580.00 5954601200 $580.00 5954601300 $580.00 5954601400 $580.00 5954601500 $580.00 5954601600 $580.00 5954601700 $580.00 5954601800 $580.00 5954601900 $580.00 5954602000 $580.00 5954602100 $580.00 5954602200 $580.00 5954602300 $580.00 5954602400 $580.00 5954602500 $580.00 5954602600 $580.00 5954602700 $580.00 5954602800 $580.00 5954602900 $580.00 5954603000 $580.00 5954603100 $580.00 5954603200 $580.00 5954603300 $580.00 5954603500 $580.00 5954603800 $580.00 Assessment Roll Page 141 of 189 City of Chula Vista Engineer's ReportPage 356 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-40 - OSD 31 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954603900 $580.00 5954604000 $580.00 5954604100 $580.00 5954604200 $580.00 5954604300 $580.00 5954604400 $580.00 5954604500 $580.00 5954604600 $580.00 5954604700 $580.00 5954604800 $580.00 5954604900 $580.00 5954605000 $580.00 5954605100 $580.00 5954605200 $580.00 5954605300 $580.00 5954605800 $580.00 5954605900 $580.00 5954700100 $580.00 5954700200 $580.00 5954700300 $580.00 5954700400 $580.00 5954700500 $580.00 5954700600 $580.00 5954700700 $580.00 5954700800 $580.00 5954700900 $580.00 5954701000 $580.00 5954701100 $580.00 5954701200 $580.00 5954701300 $580.00 5954701400 $580.00 5954701500 $580.00 5954701600 $580.00 5954701700 $580.00 5954701800 $580.00 5954701900 $580.00 5954702000 $580.00 5954702100 $580.00 5954702200 $580.00 5954702300 $580.00 5954702400 $580.00 5954702500 $580.00 5954702600 $580.00 5954702700 $580.00 5954702800 $580.00 5954702900 $580.00 5954703000 $580.00 5954703100 $580.00 5954703200 $580.00 5954703300 $580.00 5954703400 $580.00 5954703500 $580.00 5954703600 $580.00 5954703700 $580.00 5954703800 $580.00 5954703900 $580.00 5954704000 $580.00 5954704100 $580.00 5954704200 $580.00 5954704300 $580.00 5954704400 $580.00 5954800100 $580.00 5954800200 $580.00 5954800300 $580.00 5954800400 $580.00 5954800500 $580.00 5954800600 $580.00 5954800700 $580.00 5954800800 $580.00 5954800900 $580.00 5954801000 $580.00 5954801100 $580.00 5954801200 $580.00 5954801300 $580.00 5954801400 $580.00 5954801500 $580.00 5954801600 $580.00 5954801700 $580.00 5954801800 $580.00 5954801900 $580.00 5954802000 $580.00 5954802100 $580.00 5954802200 $580.00 5954802300 $580.00 5954802400 $580.00 5954802500 $580.00 5954802600 $580.00 5954802700 $580.00 5954802800 $580.00 5954802900 $580.00 5954803000 $580.00 5954803100 $580.00 5954810100 $580.00 5954810200 $580.00 5954810300 $580.00 5954810400 $580.00 5954810500 $580.00 5954810600 $580.00 5954810700 $580.00 5954810800 $580.00 5954810900 $580.00 5954811000 $580.00 5954811100 $580.00 5954811200 $580.00 5954811300 $580.00 5954811400 $580.00 5954811500 $580.00 5954811600 $580.00 5954811700 $580.00 5954811800 $580.00 5954811900 $580.00 5954812000 $580.00 5954812100 $580.00 5954812200 $580.00 5954812300 $580.00 5954900100 $580.00 5954900200 $580.00 5954900300 $580.00 5954900400 $580.00 5954900500 $580.00 5954900600 $580.00 5954900700 $580.00 5954900800 $580.00 5954900900 $580.00 5954901000 $580.00 5954901100 $580.00 5954901200 $580.00 5954901300 $580.00 5954901500 $580.00 5954901600 $580.00 5954901700 $580.00 5954901800 $580.00 5954901900 $580.00 5954902000 $580.00 5954902100 $580.00 5954902200 $580.00 5954902300 $580.00 5954902400 $580.00 5954902500 $580.00 5954902600 $580.00 5954902700 $580.00 Page 142 of 189 City of Chula Vista Engineer's ReportPage 357 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-40 - OSD 31 Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954902800 $580.00 5954902900 $580.00 5956200100 $580.00 5956200200 $580.00 5956200300 $580.00 5956200400 $580.00 5956200500 $580.00 5956200600 $580.00 5956200700 $580.00 5956200800 $580.00 5956200900 $580.00 5956201000 $580.00 5956201100 $580.00 5956201200 $580.00 5956201300 $580.00 5956201400 $580.00 5956201500 $580.00 5956201600 $580.00 5956201700 $580.00 5956201800 $580.00 5956201900 $580.00 5956202000 $580.00 5956202100 $580.00 5956202200 $580.00 5956202300 $580.00 5956202400 $580.00 5956202500 $580.00 5956202600 $580.00 5956202700 $580.00 5956202800 $580.00 5956202900 $580.00 5956203000 $580.00 5956203100 $580.00 5956203200 $580.00 5956203300 $580.00 5956203400 $580.00 5956203500 $580.00 5956203600 $580.00 5956203700 $580.00 5956203800 $580.00 5956203900 $580.00 5956204000 $580.00 5956204100 $580.00 5956204200 $580.00 5956204300 $580.00 5956204400 $580.00 5956204500 $580.00 5956204600 $580.00 5956204700 $580.00 5956204800 $580.00 5956204900 $580.00 5956205000 $580.00 5956205100 $580.00 5956205200 $580.00 5956205300 $580.00 5956205400 $580.00 5956205500 $580.00 5956205600 $580.00 5956205700 $580.00 5956205800 $580.00 5956205900 $580.00 5956206000 $580.00 Totals Parcels 344 Levy $199,520.00 Page 143 of 189 City of Chula Vista Engineer's ReportPage 358 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-13 - OSD Bay Blvd Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5670212900 $2,474.16 5670213600 $2,573.92 5670213700 $3,471.82 5670213800 $4,230.02 Totals Parcels 4 Levy $12,749.92 Assessment Roll Page 144 of 189 City of Chula Vista Engineer's ReportPage 359 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5950711001 $109.38 5950711002 $109.38 5950711003 $109.38 5950711004 $109.38 5950711005 $109.38 5950711006 $109.38 5950711007 $109.38 5950711008 $109.38 5950711009 $109.38 5950711010 $109.38 5950711011 $109.38 5950711012 $109.38 5950711013 $109.38 5950711014 $109.38 5950711015 $109.38 5950711016 $109.38 5950711500 $5,247.26 5950711600 $566.44 5950720100 $11,055.78 5950720200 $1,341.10 5950720300 $737.60 5950720400 $8,465.76 5950720500 $1,030.96 5950720600 $804.66 5950720700 $2,816.32 5950720800 $435.86 5950720900 $402.32 5950721000 $720.84 5950721100 $628.64 5950721200 $1,114.78 5950721300 $318.50 5951910100 $16.76 5951910200 $16.76 5951910300 $16.76 5951910400 $16.76 5951910500 $16.76 5951910600 $16.76 5951910700 $16.76 5951910800 $16.76 5951910900 $16.76 5951911000 $16.76 5951911100 $16.76 5951911200 $16.76 5951911300 $16.76 5951911400 $16.76 5951911500 $16.76 5951911600 $16.76 5951911700 $16.76 5951911800 $16.76 5951911900 $16.76 5951920100 $16.76 5951920200 $16.76 5951920300 $16.76 5951920400 $16.76 5951920500 $16.76 5951920600 $16.76 5951920700 $16.76 5951920800 $16.76 5951920900 $16.76 5951921000 $16.76 5951921100 $16.76 5951921200 $16.76 5951930100 $16.76 5951930200 $16.76 5951930300 $16.76 5951930400 $16.76 5951930500 $16.76 5951930600 $16.76 5951930700 $16.76 5951930800 $16.76 5951930900 $16.76 5951931000 $16.76 5951931100 $16.76 5951931200 $16.76 5951931300 $16.76 5951931400 $16.76 5951931500 $16.76 5951931600 $16.76 5951931700 $16.76 5951931800 $16.76 5951932300 $16.76 5951932400 $16.76 5951932500 $16.76 5951932600 $16.76 5951932700 $16.76 5951932800 $16.76 5951932900 $16.76 5951933000 $16.76 5951933100 $16.76 5951933200 $16.76 5951933300 $16.76 5951933400 $16.76 5951933500 $16.76 5951933600 $16.76 5951933700 $16.76 5951933800 $16.76 5951933900 $16.76 5951934000 $16.76 5951934100 $16.76 5951934200 $16.76 5951934300 $16.76 5951934400 $16.76 5951934500 $16.76 5951934600 $16.76 5951934700 $16.76 5951934800 $16.76 5951934900 $16.76 5951935000 $16.76 5951935100 $16.76 5951935200 $16.76 5951935300 $16.76 5951935400 $16.76 5951935500 $16.76 5951935600 $16.76 5951935700 $16.76 5951935900 $16.76 5951936000 $16.76 5951936100 $16.76 5951936200 $16.76 5952010100 $16.76 5952010200 $16.76 5952010300 $16.76 5952010400 $16.76 5952010500 $16.76 5952010600 $16.76 5952010700 $16.76 5952010800 $16.76 5952010900 $16.76 5952011000 $16.76 5952011100 $16.76 5952011200 $16.76 5952011300 $16.76 5952011400 $16.76 5952011500 $16.76 5952011600 $16.76 5952011700 $16.76 5952011800 $16.76 5952011900 $16.76 5952012000 $16.76 5952012100 $16.76 5952012200 $16.76 Assessment Roll Page 145 of 189 City of Chula Vista Engineer's ReportPage 360 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952012300 $16.76 5952012400 $16.76 5952012500 $16.76 5952012600 $16.76 5952020100 $16.76 5952020200 $16.76 5952020300 $16.76 5952020400 $16.76 5952020600 $16.76 5952020700 $16.76 5952020800 $16.76 5952020900 $16.76 5952021000 $16.76 5952021100 $16.76 5952021200 $16.76 5952021300 $16.76 5952021400 $16.76 5952021500 $16.76 5952021600 $16.76 5952021700 $16.76 5952021800 $16.76 5952021900 $16.76 5952022000 $16.76 5952022100 $16.76 5952022200 $16.76 5952022300 $16.76 5952022400 $16.76 5952022500 $16.76 5952022600 $16.76 5952022700 $16.76 5952022800 $16.76 5952022900 $16.76 5952023000 $16.76 5952023100 $16.76 5952023200 $16.76 5952023300 $16.76 5952023400 $16.76 5952023500 $16.76 5952023600 $16.76 5952023700 $16.76 5952023800 $16.76 5952023900 $16.76 5952024000 $16.76 5952024100 $16.76 5952024200 $16.76 5952024300 $16.76 5952024400 $16.76 5952024500 $16.76 5952024600 $16.76 5952024700 $16.76 5952024800 $16.76 5952024900 $16.76 5952025000 $16.76 5952025100 $16.76 5952025200 $16.76 5952025300 $16.76 5952025400 $16.76 5952025500 $16.76 5952025600 $16.76 5952025700 $16.76 5952025800 $16.76 5952026000 $16.76 5952030100 $16.76 5952030200 $16.76 5952030300 $16.76 5952030400 $16.76 5952030500 $16.76 5952030600 $16.76 5952030700 $16.76 5952030800 $16.76 5952030900 $16.76 5952031000 $16.76 5952031100 $16.76 5952031200 $16.76 5952031300 $16.76 5952031400 $16.76 5952031500 $16.76 5952031600 $16.76 5952031700 $16.76 5952031800 $16.76 5952031900 $16.76 5952032000 $16.76 5952032100 $16.76 5952032200 $16.76 5952032300 $16.76 5952032400 $16.76 5952032500 $16.76 5952032600 $16.76 5952032700 $16.76 5952032800 $16.76 5952032900 $16.76 5952033000 $16.76 5952033100 $16.76 5952033200 $16.76 5952033300 $16.76 5952033400 $16.76 5952033500 $16.76 5952033600 $16.76 5952033700 $16.76 5952033800 $16.76 5952033900 $16.76 5952034000 $16.76 5952034100 $16.76 5952034200 $16.76 5952034300 $16.76 5952034400 $16.76 5952034500 $16.76 5952034600 $16.76 5952034700 $16.76 5952034800 $16.76 5952034900 $16.76 5952035000 $16.76 5952035100 $16.76 5952035200 $16.76 5952035300 $16.76 5952035400 $16.76 5952110100 $16.76 5952110200 $16.76 5952110300 $16.76 5952110400 $16.76 5952110500 $16.76 5952110600 $16.76 5952110700 $16.76 5952110800 $16.76 5952110900 $16.76 5952111000 $16.76 5952111100 $16.76 5952111200 $16.76 5952111300 $16.76 5952111400 $16.76 5952111500 $16.76 5952111600 $16.76 5952111700 $16.76 5952111800 $16.76 5952111900 $16.76 5952112000 $16.76 5952112100 $16.76 5952112200 $16.76 5952112300 $16.76 5952112400 $16.76 5952112500 $16.76 Page 146 of 189 City of Chula Vista Engineer's ReportPage 361 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952112600 $16.76 5952112700 $16.76 5952112800 $16.76 5952112900 $16.76 5952113000 $16.76 5952113100 $16.76 5952113200 $16.76 5952113300 $16.76 5952113400 $16.76 5952113500 $16.76 5952113600 $16.76 5952113700 $16.76 5952113800 $16.76 5952113900 $16.76 5952114000 $16.76 5952114100 $16.76 5952114200 $16.76 5952114300 $16.76 5952114400 $16.76 5952114500 $16.76 5952120100 $16.76 5952120200 $16.76 5952120300 $16.76 5952120400 $16.76 5952120500 $16.76 5952120600 $16.76 5952120700 $16.76 5952120800 $16.76 5952120900 $16.76 5952121000 $16.76 5952121100 $16.76 5952121200 $16.76 5952121300 $16.76 5952121400 $16.76 5952121500 $16.76 5952121600 $16.76 5952121700 $16.76 5952121800 $16.76 5952121900 $16.76 5952122000 $16.76 5952122100 $16.76 5952122200 $16.76 5952122300 $16.76 5952130100 $16.76 5952130200 $16.76 5952130300 $16.76 5952130400 $16.76 5952130500 $16.76 5952130600 $16.76 5952130700 $16.76 5952130800 $16.76 5952130900 $16.76 5952131000 $16.76 5952131100 $16.76 5952131200 $16.76 5952131300 $16.76 5952131400 $16.76 5952131500 $16.76 5952131600 $16.76 5952131700 $16.76 5952131800 $16.76 5952131900 $16.76 5952132000 $16.76 5952132100 $16.76 5952132200 $16.76 5952132300 $16.76 5952132400 $16.76 5952132500 $16.76 5952140100 $16.76 5952140200 $16.76 5952140300 $16.76 5952140400 $16.76 5952140500 $16.76 5952140600 $16.76 5952140700 $16.76 5952140800 $16.76 5952140900 $16.76 5952141000 $16.76 5952141100 $16.76 5952141200 $16.76 5952141300 $16.76 5952141400 $16.76 5952141500 $16.76 5952141600 $16.76 5952141700 $16.76 5952141800 $16.76 5952141900 $16.76 5952142000 $16.76 5952142100 $16.76 5952142200 $16.76 5952142300 $16.76 5952142400 $16.76 5952142500 $16.76 5952142600 $16.76 5952142700 $16.76 5952142800 $16.76 5952142900 $16.76 5952143000 $16.76 5952143100 $16.76 5952143200 $16.76 5952143300 $16.76 5952143400 $16.76 5952143500 $16.76 5952143600 $16.76 5952143700 $16.76 5952143800 $16.76 5952143900 $16.76 5952144000 $16.76 5952144100 $16.76 5952144200 $16.76 5952144300 $16.76 5952144400 $16.76 5952144500 $16.76 5952144600 $16.76 5952144700 $16.76 5952144800 $16.76 5952144900 $16.76 5952145000 $16.76 5952150100 $16.76 5952150200 $16.76 5952150300 $16.76 5952150400 $16.76 5952150500 $16.76 5952150600 $16.76 5952150700 $16.76 5952150800 $16.76 5952150900 $16.76 5952151000 $16.76 5952151100 $16.76 5952151200 $16.76 5952151300 $16.76 5952151400 $16.76 5952151500 $16.76 5952151600 $16.76 5952151700 $16.76 5952151800 $16.76 5952151900 $16.76 5952152000 $16.76 5952152100 $16.76 5952152200 $16.76 5952152300 $16.76 Page 147 of 189 City of Chula Vista Engineer's ReportPage 362 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952152400 $16.76 5952152500 $16.76 5952152600 $16.76 5952152700 $16.76 5952152800 $16.76 5952152900 $16.76 5952153000 $16.76 5952153100 $16.76 5952153200 $16.76 5952153300 $16.76 5952153400 $16.76 5952153500 $16.76 5952153600 $16.76 5952153700 $16.76 5952153800 $16.76 5952153900 $16.76 5952154000 $16.76 5952154100 $16.76 5952160100 $16.76 5952160200 $16.76 5952160300 $16.76 5952160400 $16.76 5952160500 $16.76 5952160600 $16.76 5952160700 $16.76 5952160800 $16.76 5952160900 $16.76 5952161000 $16.76 5952161100 $16.76 5952161200 $16.76 5952161300 $16.76 5952161400 $16.76 5952161500 $16.76 5952161600 $16.76 5952161700 $16.76 5952161800 $16.76 5952161900 $16.76 5952162000 $16.76 5952162100 $16.76 5952162200 $16.76 5952162300 $16.76 5952162400 $16.76 5952162500 $16.76 5952162600 $16.76 5952162700 $16.76 5952162800 $16.76 5952162900 $16.76 5952163000 $16.76 5952163100 $16.76 5952163200 $16.76 5952163300 $16.76 5952163400 $16.76 5952163500 $16.76 5952163600 $16.76 5952163700 $16.76 5952163800 $16.76 5952163900 $16.76 5952164000 $16.76 5952164100 $16.76 5952164200 $16.76 5952164300 $16.76 5952210201 $13.40 5952210202 $13.40 5952210203 $13.40 5952210204 $13.40 5952210205 $13.40 5952210206 $13.40 5952210507 $13.40 5952210508 $13.40 5952210509 $13.40 5952210510 $13.40 5952210511 $13.40 5952210512 $13.40 5952210613 $13.40 5952210614 $13.40 5952210615 $13.40 5952210616 $13.40 5952210617 $13.40 5952210618 $13.40 5952210619 $13.40 5952210620 $13.40 5952210621 $13.40 5952210622 $13.40 5952210623 $13.40 5952210624 $13.40 5952210625 $13.40 5952210626 $13.40 5952210727 $13.40 5952210728 $13.40 5952210729 $13.40 5952210730 $13.40 5952210731 $13.40 5952210732 $13.40 5952210733 $13.40 5952210734 $13.40 5952210735 $13.40 5952210736 $13.40 5952210737 $13.40 5952210738 $13.40 5952210839 $13.40 5952210840 $13.40 5952210841 $13.40 5952210842 $13.40 5952210843 $13.40 5952210844 $13.40 5952210845 $13.40 5952210846 $13.40 5952210947 $13.40 5952210948 $13.40 5952210949 $13.40 5952210950 $13.40 5952210951 $13.40 5952210952 $13.40 5952210953 $13.40 5952210954 $13.40 5952210955 $13.40 5952210956 $13.40 5952211057 $13.40 5952211058 $13.40 5952211059 $13.40 5952211060 $13.40 5952211061 $13.40 5952211062 $13.40 5952211063 $13.40 5952211064 $13.40 5952211065 $13.40 5952211066 $13.40 5952211267 $13.40 5952211268 $13.40 5952211269 $13.40 5952211270 $13.40 5952211271 $13.40 5952211272 $13.40 5952211273 $13.40 5952211274 $13.40 5952211275 $13.40 5952211276 $13.40 5952211277 $13.40 5952211278 $13.40 5952211379 $13.40 5952211380 $13.40 Page 148 of 189 City of Chula Vista Engineer's ReportPage 363 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952211381 $13.40 5952211382 $13.40 5952211383 $13.40 5952211384 $13.40 5952211385 $13.40 5952211386 $13.40 5952211387 $13.40 5952211388 $13.40 5952211389 $13.40 5952211390 $13.40 5952211391 $13.40 5952211392 $13.40 5952211401 $13.40 5952211402 $13.40 5952211403 $13.40 5952211404 $13.40 5952211405 $13.40 5952211406 $13.40 5952211407 $13.40 5952211408 $13.40 5952211409 $13.40 5952211410 $13.40 5952211411 $13.40 5952211412 $13.40 5952211501 $13.40 5952211502 $13.40 5952211503 $13.40 5952211504 $13.40 5952211505 $13.40 5952211506 $13.40 5952211507 $13.40 5952211508 $13.40 5952211509 $13.40 5952211510 $13.40 5952211511 $13.40 5952211512 $13.40 5952211513 $13.40 5952211514 $13.40 5952211601 $13.40 5952211602 $13.40 5952211603 $13.40 5952211604 $13.40 5952211605 $13.40 5952211606 $13.40 5952211607 $13.40 5952211608 $13.40 5952211701 $13.40 5952211702 $13.40 5952211703 $13.40 5952211704 $13.40 5952211801 $13.40 5952211802 $13.40 5952211803 $13.40 5952211804 $13.40 5952211805 $13.40 5952211806 $13.40 5952211807 $13.40 5952211808 $13.40 5952211901 $13.40 5952211902 $13.40 5952211903 $13.40 5952211904 $13.40 5952211905 $13.40 5952211906 $13.40 5952211907 $13.40 5952211908 $13.40 5952211909 $13.40 5952211910 $13.40 5952211911 $13.40 5952211912 $13.40 5952212001 $13.40 5952212002 $13.40 5952212003 $13.40 5952212004 $13.40 5952212005 $13.40 5952212006 $13.40 5952212007 $13.40 5952212008 $13.40 5952212009 $13.40 5952212010 $13.40 5952212011 $13.40 5952212012 $13.40 5952212013 $13.40 5952212014 $13.40 5952212101 $13.40 5952212102 $13.40 5952212103 $13.40 5952212104 $13.40 5952212105 $13.40 5952212106 $13.40 5952212107 $13.40 5952212108 $13.40 5952212109 $13.40 5952212110 $13.40 5952212111 $13.40 5952212112 $13.40 5952212113 $13.40 5952212114 $13.40 5952212115 $13.40 5952212116 $13.40 5952212201 $13.40 5952212202 $13.40 5952212203 $13.40 5952212204 $13.40 5952212205 $13.40 5952212206 $13.40 5952212207 $13.40 5952212208 $13.40 5952212209 $13.40 5952212210 $13.40 5952212211 $13.40 5952212212 $13.40 5952212213 $13.40 5952212214 $13.40 5952212215 $13.40 5952212216 $13.40 5952212301 $13.40 5952212302 $13.40 5952212303 $13.40 5952212304 $13.40 5952212305 $13.40 5952212306 $13.40 5952212307 $13.40 5952212308 $13.40 5952212309 $13.40 5952212310 $13.40 5952212311 $13.40 5952212312 $13.40 5952212313 $13.40 5952212314 $13.40 5952212315 $13.40 5952212316 $13.40 5952212401 $13.40 5952212402 $13.40 5952212403 $13.40 5952212404 $13.40 5952212405 $13.40 5952212406 $13.40 5952212407 $13.40 5952212408 $13.40 5952212409 $13.40 Page 149 of 189 City of Chula Vista Engineer's ReportPage 364 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952212410 $13.40 5952212411 $13.40 5952212412 $13.40 5952212501 $13.40 5952212502 $13.40 5952212503 $13.40 5952212504 $13.40 5952212505 $13.40 5952212506 $13.40 5952212507 $13.40 5952212508 $13.40 5952220124 $13.40 5952220125 $13.40 5952220126 $13.40 5952220127 $13.40 5952220128 $13.40 5952220129 $13.40 5952220130 $13.40 5952220131 $13.40 5952220132 $13.40 5952220133 $13.40 5952220134 $13.40 5952220135 $13.40 5952220136 $13.40 5952220137 $13.40 5952220138 $13.40 5952220139 $13.40 5952220140 $13.40 5952220141 $13.40 5952220142 $13.40 5952220143 $13.40 5952220144 $13.40 5952220145 $13.40 5952220146 $13.40 5952220147 $13.40 5952220148 $13.40 5952220149 $13.40 5952220150 $13.40 5952220151 $13.40 5952220152 $13.40 5952220153 $13.40 5952220154 $13.40 5952220355 $13.40 5952220356 $13.40 5952220357 $13.40 5952220358 $13.40 5952220359 $13.40 5952220360 $13.40 5952220361 $13.40 5952220362 $13.40 5952220363 $13.40 5952220364 $13.40 5952220365 $13.40 5952220366 $13.40 5952220367 $13.40 5952220368 $13.40 5952220369 $13.40 5952220370 $13.40 5952220371 $13.40 5952220372 $13.40 5952220373 $13.40 5952220374 $13.40 5952220375 $13.40 5952220376 $13.40 5952220377 $13.40 5952220378 $13.40 5952220379 $13.40 5952220380 $13.40 5952220381 $13.40 5952220382 $13.40 5952220383 $13.40 5952220384 $13.40 5952220385 $13.40 5952220386 $13.40 5952220387 $13.40 5952220388 $13.40 5952220401 $13.40 5952220402 $13.40 5952220403 $13.40 5952220404 $13.40 5952220405 $13.40 5952220406 $13.40 5952220407 $13.40 5952220408 $13.40 5952220409 $13.40 5952220410 $13.40 5952220411 $13.40 5952220412 $13.40 5952220413 $13.40 5952220414 $13.40 5952220415 $13.40 5952220416 $13.40 5952220417 $13.40 5952220418 $13.40 5952220419 $13.40 5952220420 $13.40 5952220421 $13.40 5952220422 $13.40 5952220423 $13.40 5952220424 $13.40 5952220501 $13.40 5952220502 $13.40 5952220503 $13.40 5952220504 $13.40 5952220505 $13.40 5952220506 $13.40 5952220507 $13.40 5952220508 $13.40 5952220509 $13.40 5952220510 $13.40 5952220511 $13.40 5952220512 $13.40 5952220513 $13.40 5952220514 $13.40 5952220515 $13.40 5952220516 $13.40 5952220517 $13.40 5952220518 $13.40 5952220519 $13.40 5952220520 $13.40 5952220521 $13.40 5952220522 $13.40 5952220523 $13.40 5952221301 $13.40 5952221302 $13.40 5952221303 $13.40 5952221304 $13.40 5952221305 $13.40 5952221306 $13.40 5952221307 $13.40 5952221308 $13.40 5952221309 $13.40 5952221310 $13.40 5952221311 $13.40 5952221312 $13.40 5952221313 $13.40 5952221314 $13.40 5952221315 $13.40 5952221316 $13.40 5952221317 $13.40 5952221318 $13.40 Page 150 of 189 City of Chula Vista Engineer's ReportPage 365 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952221539 $13.40 5952221540 $13.40 5952221541 $13.40 5952221542 $13.40 5952221543 $13.40 5952221544 $13.40 5952221545 $13.40 5952221546 $13.40 5952221547 $13.40 5952221548 $13.40 5952221549 $13.40 5952221550 $13.40 5952221551 $13.40 5952221552 $13.40 5952221553 $13.40 5952221554 $13.40 5952221555 $13.40 5952221556 $13.40 5952221557 $13.40 5952221558 $13.40 5952221559 $13.40 5952221560 $13.40 5952221561 $13.40 5952221562 $13.40 5952221563 $13.40 5952221564 $13.40 5952221565 $13.40 5952221566 $13.40 5952221567 $13.40 5952221568 $13.40 5952221569 $13.40 5952221570 $13.40 5952221571 $13.40 5952221572 $13.40 5952221573 $13.40 5952221574 $13.40 5952221575 $13.40 5952221576 $13.40 5952221577 $13.40 5952221578 $13.40 5952221579 $13.40 5952221580 $13.40 5952221581 $13.40 5952221582 $13.40 5952221601 $13.40 5952221602 $13.40 5952221603 $13.40 5952221604 $13.40 5952221605 $13.40 5952221606 $13.40 5952221607 $13.40 5952221608 $13.40 5952221609 $13.40 5952221610 $13.40 5952221611 $13.40 5952221612 $13.40 5952221613 $13.40 5952221614 $13.40 5952221615 $13.40 5952221616 $13.40 5952221617 $13.40 5952221618 $13.40 5952221619 $13.40 5952221620 $13.40 5952221621 $13.40 5952221622 $13.40 5952221623 $13.40 5952221624 $13.40 5952221625 $13.40 5952221626 $13.40 5952221627 $13.40 5952221628 $13.40 5952221629 $13.40 5952221630 $13.40 5952221631 $13.40 5952221632 $13.40 5952221701 $13.40 5952221702 $13.40 5952221703 $13.40 5952221704 $13.40 5952221705 $13.40 5952221706 $13.40 5952221707 $13.40 5952221708 $13.40 5952221709 $13.40 5952221710 $13.40 5952221711 $13.40 5952221712 $13.40 5952221713 $13.40 5952221714 $13.40 5952221715 $13.40 5952221716 $13.40 5952221717 $13.40 5952221718 $13.40 5952221719 $13.40 5952221720 $13.40 5952221721 $13.40 5952221722 $13.40 5952221723 $13.40 5952221724 $13.40 5952221725 $13.40 5952221726 $13.40 5952221727 $13.40 5952221728 $13.40 5952221729 $13.40 5952221730 $13.40 5952221731 $13.40 5952221732 $13.40 5952221733 $13.40 5952221734 $13.40 5952221735 $13.40 5952221736 $13.40 5952221737 $13.40 5952221738 $13.40 5952221739 $13.40 5952221740 $13.40 5952221901 $13.40 5952221902 $13.40 5952221903 $13.40 5952221904 $13.40 5952221905 $13.40 5952221906 $13.40 5952221907 $13.40 5952221908 $13.40 5952221909 $13.40 5952221910 $13.40 5952221911 $13.40 5952221912 $13.40 5952221913 $13.40 5952221914 $13.40 5952221915 $13.40 5952221916 $13.40 5952221917 $13.40 5952221918 $13.40 5952221919 $13.40 5952221920 $13.40 5952221921 $13.40 5952221922 $13.40 5952221923 $13.40 5952221924 $13.40 5952221925 $13.40 Page 151 of 189 City of Chula Vista Engineer's ReportPage 366 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952221926 $13.40 5952221927 $13.40 5952221928 $13.40 5952221929 $13.40 5952221930 $13.40 5952221931 $13.40 5952221932 $13.40 5952221933 $13.40 5952221934 $13.40 5952221935 $13.40 5952221936 $13.40 5952221937 $13.40 5952221938 $13.40 5952222101 $13.40 5952222102 $13.40 5952222103 $13.40 5952222104 $13.40 5952222105 $13.40 5952222106 $13.40 5952222107 $13.40 5952222108 $13.40 5952222109 $13.40 5952222110 $13.40 5952222111 $13.40 5952222112 $13.40 5952222113 $13.40 5952222114 $13.40 5952222115 $13.40 5952222116 $13.40 5952222117 $13.40 5952222118 $13.40 5952222119 $13.40 5952222120 $13.40 5952222121 $13.40 5952222122 $13.40 5952222123 $13.40 5952222124 $13.40 5952222125 $13.40 5952222126 $13.40 5952222127 $13.40 5952222128 $13.40 5952222129 $13.40 5952222130 $13.40 5952222131 $13.40 5952222132 $13.40 5952222133 $13.40 5952222134 $13.40 5952222135 $13.40 5952222136 $13.40 5952222137 $13.40 5952222138 $13.40 5952222139 $13.40 5952222140 $13.40 5952222141 $13.40 5952222142 $13.40 5952222143 $13.40 5952222144 $13.40 5952222201 $13.40 5952222202 $13.40 5952222203 $13.40 5952222204 $13.40 5952222205 $13.40 5952222206 $13.40 5952222207 $13.40 5952222208 $13.40 5952222209 $13.40 5952222210 $13.40 5952222211 $13.40 5952222212 $13.40 5952222213 $13.40 5952222214 $13.40 5952222215 $13.40 5952222216 $13.40 5952222217 $13.40 5952222218 $13.40 5952222219 $13.40 5952222220 $13.40 5952222221 $13.40 5952222222 $13.40 5952222223 $13.40 5952222224 $13.40 5952222225 $13.40 5952222226 $13.40 5952222227 $13.40 5952222228 $13.40 5952222229 $13.40 5952222230 $13.40 5952222231 $13.40 5952222232 $13.40 5952222233 $13.40 5952222234 $13.40 5952222235 $13.40 5952222236 $13.40 5952222237 $13.40 5952222238 $13.40 5952222239 $13.40 5952222240 $13.40 5952222301 $13.40 5952222302 $13.40 5952222303 $13.40 5952222304 $13.40 5952222305 $13.40 5952222306 $13.40 5952222307 $13.40 5952222308 $13.40 5952222309 $13.40 5952222310 $13.40 5952222311 $13.40 5952222312 $13.40 5952222313 $13.40 5952222314 $13.40 5952222315 $13.40 5952222316 $13.40 5952222317 $13.40 5952222318 $13.40 5952222319 $13.40 5952222320 $13.40 5952222321 $13.40 5952222322 $13.40 5952222323 $13.40 5952222324 $13.40 5952222325 $13.40 5952222326 $13.40 5952222327 $13.40 5952222328 $13.40 5952222329 $13.40 5952222330 $13.40 5952222331 $13.40 5952222332 $13.40 5952222333 $13.40 5952222334 $13.40 5952222335 $13.40 5952222336 $13.40 5952222337 $13.40 5952222338 $13.40 5952222339 $13.40 5952222340 $13.40 5952222341 $13.40 5952222342 $13.40 5952222343 $13.40 5952222344 $13.40 Page 152 of 189 City of Chula Vista Engineer's ReportPage 367 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952222501 $13.40 5952222502 $13.40 5952222503 $13.40 5952222504 $13.40 5952222505 $13.40 5952222506 $13.40 5952222507 $13.40 5952222508 $13.40 5952222509 $13.40 5952222510 $13.40 5952222511 $13.40 5952222512 $13.40 5952222513 $13.40 5952222514 $13.40 5952222515 $13.40 5952222516 $13.40 5952222517 $13.40 5952222518 $13.40 5952222519 $13.40 5952222520 $13.40 5952222521 $13.40 5952222522 $13.40 5952222523 $13.40 5952222524 $13.40 5952222525 $13.40 5952222526 $13.40 5952222527 $13.40 5952222528 $13.40 5952222529 $13.40 5952222530 $13.40 5952222531 $13.40 5952222532 $13.40 5952222533 $13.40 5952222534 $13.40 5952222535 $13.40 5952222536 $13.40 5952222537 $13.40 5952222538 $13.40 5952222539 $13.40 5952222540 $13.40 5952222541 $13.40 5952222542 $13.40 5952222543 $13.40 5952222544 $13.40 5952222545 $13.40 5952222546 $13.40 5952222547 $13.40 5952222548 $13.40 5952222549 $13.40 5952222550 $13.40 5952222551 $13.40 5952222552 $13.40 5952222553 $13.40 5952222554 $13.40 5952222555 $13.40 5952222556 $13.40 5952222601 $13.40 5952222602 $13.40 5952222603 $13.40 5952222604 $13.40 5952222605 $13.40 5952222606 $13.40 5952222607 $13.40 5952222608 $13.40 5952222609 $13.40 5952222610 $13.40 5952222611 $13.40 5952222612 $13.40 5952222613 $13.40 5952222614 $13.40 5952222615 $13.40 5952222616 $13.40 5952222617 $13.40 5952222618 $13.40 5952222619 $13.40 5952222620 $13.40 5952222621 $13.40 5952222622 $13.40 5952222623 $13.40 5952222624 $13.40 5952222625 $13.40 5952222626 $13.40 5952222627 $13.40 5952222628 $13.40 5952222629 $13.40 5952222630 $13.40 5952222631 $13.40 5952222632 $13.40 5952222633 $13.40 5952222634 $13.40 5952222635 $13.40 5952222636 $13.40 5952222637 $13.40 5952222638 $13.40 5952222639 $13.40 5952222640 $13.40 5952222641 $13.40 5952222642 $13.40 5952222643 $13.40 5952222644 $13.40 5952222645 $13.40 5952222646 $13.40 5952222647 $13.40 5952222648 $13.40 5952222649 $13.40 5952222650 $13.40 5952222651 $13.40 5952222652 $13.40 5952222653 $13.40 5952222654 $13.40 5952222655 $13.40 5952222656 $13.40 5952222657 $13.40 5952222658 $13.40 5952222659 $13.40 5952222660 $13.40 5952222661 $13.40 5952222662 $13.40 5952222663 $13.40 5952222664 $13.40 5952222665 $13.40 5952222666 $13.40 5952310100 $930.38 5952310200 $819.74 5952310800 $1,106.40 5952310900 $1,126.52 5952311200 $3,042.64 5952311300 $2,137.38 5952312100 $819.74 5952312200 $824.78 5952312300 $839.86 5952312400 $2,243.00 5952312900 $1,745.12 5952313100 $1,584.18 5952313200 $2,152.48 5952313300 $2,715.74 5952313400 $1,136.58 5952313500 $3,495.26 5952313600 $1,850.72 5952313700 $724.20 5952313900 $387.24 Page 153 of 189 City of Chula Vista Engineer's ReportPage 368 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952314000 $261.50 5952314100 $261.50 5952314200 $148.50 5952314300 $206.96 5952314400 $226.34 5952314500 $316.82 5952314600 $281.62 5952314700 $205.72 5952314800 $205.86 5952314900 $179.26 5952315000 $245.06 5952320400 $804.66 5952320500 $779.52 5952320600 $1,086.30 5952321100 $628.64 5952322500 $688.98 5952322800 $28.66 5952323000 $796.28 5952323100 $704.08 5952323400 $1,076.24 5952323701 $1,644.72 5952323702 $765.00 5952323703 $1,644.72 5952323704 $803.24 5952323705 $726.74 5952323800 $7,197.98 5952323900 $827.70 5952410100 $16.76 5952410200 $16.76 5952410300 $16.76 5952410400 $16.76 5952410500 $16.76 5952410600 $16.76 5952410700 $16.76 5952410800 $16.76 5952410900 $16.76 5952411000 $16.76 5952411100 $16.76 5952411200 $16.76 5952411300 $16.76 5952411400 $16.76 5952411500 $16.76 5952411600 $16.76 5952411700 $16.76 5952411800 $16.76 5952411900 $16.76 5952412000 $16.76 5952412100 $16.76 5952412200 $16.76 5952412300 $16.76 5952412400 $16.76 5952412500 $16.76 5952412600 $16.76 5952412700 $16.76 5952412800 $16.76 5952412900 $16.76 5952413000 $16.76 5952413100 $16.76 5952413200 $16.76 5952413300 $16.76 5952413400 $16.76 5952413500 $16.76 5952413600 $16.76 5952413700 $16.76 5952413800 $16.76 5952413900 $16.76 5952414000 $16.76 5952414100 $16.76 5952414200 $16.76 5952414300 $16.76 5952414400 $16.76 5952414500 $16.76 5952414600 $16.76 5952414700 $16.76 5952414800 $16.76 5952414900 $16.76 5952415000 $16.76 5952415100 $16.76 5952420100 $16.76 5952420200 $16.76 5952420300 $16.76 5952420400 $16.76 5952420500 $16.76 5952420600 $16.76 5952420700 $16.76 5952420800 $16.76 5952420900 $16.76 5952421000 $16.76 5952421100 $16.76 5952421200 $16.76 5952421300 $16.76 5952421400 $16.76 5952421500 $16.76 5952421600 $16.76 5952421700 $16.76 5952421800 $16.76 5952421900 $16.76 5952422000 $16.76 5952422100 $16.76 5952422200 $16.76 5952422300 $16.76 5952422400 $16.76 5952422500 $16.76 5952422600 $16.76 5952422700 $16.76 5952422800 $16.76 5952422900 $16.76 5952423000 $16.76 5952423100 $16.76 5952423200 $16.76 5952423300 $16.76 5952423400 $16.76 5952423500 $16.76 5952423600 $16.76 5952423700 $16.76 5952423800 $16.76 5952423900 $16.76 5952424000 $16.76 5952424100 $16.76 5952424200 $16.76 5952424300 $16.76 5952424400 $16.76 5952424500 $16.76 5952424600 $16.76 5952424700 $16.76 5952424800 $16.76 5952424900 $16.76 5952510100 $16.76 5952510200 $16.76 5952510300 $16.76 5952510400 $16.76 5952510500 $16.76 5952510600 $16.76 5952510700 $16.76 5952510800 $16.76 5952510900 $16.76 5952511000 $16.76 5952511100 $16.76 5952511200 $16.76 5952511300 $16.76 5952511400 $16.76 Page 154 of 189 City of Chula Vista Engineer's ReportPage 369 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952511500 $16.76 5952511600 $16.76 5952511700 $16.76 5952511800 $16.76 5952511900 $16.76 5952512000 $16.76 5952512100 $16.76 5952512200 $16.76 5952512300 $16.76 5952512400 $16.76 5952512500 $16.76 5952512600 $16.76 5952512700 $16.76 5952512800 $16.76 5952512900 $16.76 5952513000 $16.76 5952513100 $16.76 5952513200 $16.76 5952513300 $16.76 5952513400 $16.76 5952513500 $16.76 5952513600 $16.76 5952520100 $16.76 5952520200 $16.76 5952520300 $16.76 5952520400 $16.76 5952520500 $16.76 5952520600 $16.76 5952520700 $16.76 5952520800 $16.76 5952520900 $16.76 5952521000 $16.76 5952521100 $16.76 5952521200 $16.76 5952521300 $16.76 5952521400 $16.76 5952521500 $16.76 5952521600 $16.76 5952521800 $16.76 5952521900 $16.76 5952522000 $16.76 5952522100 $16.76 5952522400 $16.76 5952522500 $16.76 5952522600 $16.76 5952522700 $16.76 5952522800 $16.76 5952522900 $16.76 5952523000 $16.76 5952523100 $16.76 5952523200 $16.76 5952523300 $16.76 5952523400 $16.76 5952523500 $16.76 5952523600 $16.76 5952530100 $16.76 5952530200 $16.76 5952530300 $16.76 5952530400 $16.76 5952530500 $16.76 5952530600 $16.76 5952530700 $16.76 5952530800 $16.76 5952530900 $16.76 5952531000 $16.76 5952531100 $16.76 5952531200 $16.76 5952531300 $16.76 5952531400 $16.76 5952531500 $16.76 5952531600 $16.76 5952531900 $16.76 5952532000 $16.76 5952532100 $16.76 5952532200 $16.76 5952532300 $16.76 5952532400 $16.76 5952532500 $16.76 5952532600 $16.76 5952532700 $16.76 5952532800 $16.76 5952532900 $16.76 5952533000 $16.76 5952533100 $16.76 5952533200 $16.76 5952533300 $16.76 5952533400 $16.76 5952533500 $16.76 5952533600 $16.76 5952533700 $16.76 5952533800 $16.76 5952533900 $16.76 5952534000 $16.76 5952534100 $16.76 5952534200 $16.76 5952534300 $16.76 5952534400 $16.76 5952534500 $16.76 5952534600 $16.76 5952534700 $16.76 5952534800 $16.76 5952534900 $16.76 5952535000 $16.76 5952610100 $16.76 5952610200 $16.76 5952610300 $16.76 5952610400 $16.76 5952610500 $16.76 5952610600 $16.76 5952610700 $16.76 5952610800 $16.76 5952610900 $16.76 5952611000 $16.76 5952611100 $16.76 5952611200 $16.76 5952611300 $16.76 5952611400 $16.76 5952611500 $16.76 5952611600 $16.76 5952611700 $16.76 5952611800 $16.76 5952611900 $16.76 5952612000 $16.76 5952612100 $16.76 5952612200 $16.76 5952612300 $16.76 5952612400 $16.76 5952612500 $16.76 5952612600 $16.76 5952612700 $16.76 5952612800 $16.76 5952612900 $16.76 5952613000 $16.76 5952613100 $16.76 5952613200 $16.76 5952613300 $16.76 5952613400 $16.76 5952613500 $16.76 5952613600 $16.76 5952613700 $16.76 5952613800 $16.76 Page 155 of 189 City of Chula Vista Engineer's ReportPage 370 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952613900 $16.76 5952614000 $16.76 5952614100 $16.76 5952614200 $16.76 5952614300 $16.76 5952614400 $16.76 5952614500 $16.76 5952614600 $16.76 5952614700 $16.76 5952614800 $16.76 5952614900 $16.76 5952615000 $16.76 5952615100 $16.76 5952615200 $16.76 5952615300 $16.76 5952615400 $16.76 5952615500 $16.76 5952615600 $16.76 5952615700 $16.76 5952615800 $16.76 5952615900 $16.76 5952616000 $16.76 5952616100 $16.76 5952616200 $16.76 5952616300 $16.76 5952620100 $16.76 5952620200 $16.76 5952620300 $16.76 5952620400 $16.76 5952620500 $16.76 5952620600 $16.76 5952620700 $16.76 5952620800 $16.76 5952620900 $16.76 5952621000 $16.76 5952621100 $16.76 5952621200 $16.76 5952621300 $16.76 5952621400 $16.76 5952621500 $16.76 5952621600 $16.76 5952621700 $16.76 5952621800 $16.76 5952621900 $16.76 5952622000 $16.76 5952622100 $16.76 5952622200 $16.76 5952622300 $16.76 5952622400 $16.76 5952622500 $16.76 5952622600 $16.76 5952622700 $16.76 5952622900 $16.76 5952623000 $16.76 5952623100 $16.76 5952623200 $16.76 5952623300 $16.76 5952623400 $16.76 5952623500 $16.76 5952623600 $16.76 5952623700 $16.76 5952710100 $16.76 5952710200 $16.76 5952710300 $16.76 5952710400 $16.76 5952710500 $16.76 5952710600 $16.76 5952710700 $16.76 5952710800 $16.76 5952711100 $16.76 5952711200 $16.76 5952711300 $16.76 5952711400 $16.76 5952711500 $16.76 5952711600 $16.76 5952711700 $16.76 5952711800 $16.76 5952711900 $16.76 5952712000 $16.76 5952712100 $16.76 5952712400 $16.76 5952712500 $16.76 5952712600 $16.76 5952712700 $16.76 5952712800 $16.76 5952712900 $16.76 5952713000 $16.76 5952713200 $16.76 5952713300 $16.76 5952713500 $16.76 5952713600 $16.76 5952720100 $16.76 5952720200 $16.76 5952720300 $16.76 5952720400 $16.76 5952720500 $16.76 5952720600 $16.76 5952720700 $16.76 5952720800 $16.76 5952720900 $16.76 5952721000 $16.76 5952721100 $16.76 5952721200 $16.76 5952721300 $16.76 5952721400 $16.76 5952721500 $16.76 5952721600 $16.76 5952721700 $16.76 5952721800 $16.76 5952721900 $16.76 5952722000 $16.76 5952722100 $16.76 5952722200 $16.76 5952722300 $16.76 5952722400 $16.76 5952722500 $16.76 5952722600 $16.76 5952722700 $16.76 5952722800 $16.76 5952722900 $16.76 5952723000 $16.76 5952723100 $16.76 5952723200 $16.76 5952723300 $16.76 5952723400 $16.76 5952723500 $16.76 5952723600 $16.76 5952723700 $16.76 5952723800 $16.76 5952800100 $16.76 5952800200 $16.76 5952800300 $16.76 5952800400 $16.76 5952800500 $16.76 5952800600 $16.76 5952800700 $16.76 5952800800 $16.76 5952800900 $16.76 5952801000 $16.76 5952801100 $16.76 5952801200 $16.76 Page 156 of 189 City of Chula Vista Engineer's ReportPage 371 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952801300 $16.76 5952801400 $16.76 5952801500 $16.76 5952801600 $16.76 5952801700 $16.76 5952801800 $16.76 5952801900 $16.76 5952802000 $16.76 5952802100 $16.76 5952802200 $16.76 5952802300 $16.76 5952802400 $16.76 5952802500 $16.76 5952802600 $16.76 5952802700 $16.76 5952802800 $16.76 5952802900 $16.76 5952803000 $16.76 5952803100 $16.76 5952803200 $16.76 5952803300 $16.76 5952803400 $16.76 5952803500 $16.76 5952803600 $16.76 5952803700 $16.76 5952803800 $16.76 5952803900 $16.76 5952804000 $16.76 5952804100 $16.76 5952804200 $16.76 5952804300 $16.76 5952804400 $16.76 5952804500 $16.76 5952804600 $16.76 5952804700 $16.76 5952804800 $16.76 5952804900 $16.76 5952805000 $16.76 5952805100 $16.76 5952805200 $16.76 5952805300 $16.76 5952805400 $16.76 5952805500 $16.76 5952805600 $16.76 5952805700 $16.76 5952805800 $16.76 5952805900 $16.76 5952806000 $16.76 5952910100 $16.76 5952910200 $16.76 5952910300 $16.76 5952910400 $16.76 5952910500 $16.76 5952910600 $16.76 5952910700 $16.76 5952910800 $16.76 5952910900 $16.76 5952911000 $16.76 5952911100 $16.76 5952911200 $16.76 5952911300 $16.76 5952911400 $16.76 5952911500 $16.76 5952911600 $16.76 5952911700 $16.76 5952911800 $16.76 5952911900 $16.76 5952912000 $16.76 5952912100 $16.76 5952912200 $16.76 5952912300 $16.76 5952912400 $16.76 5952912500 $16.76 5952912800 $16.76 5952920200 $16.76 5952920300 $16.76 5952920400 $16.76 5952920500 $16.76 5952920600 $16.76 5952920700 $16.76 5952920800 $16.76 5952920900 $16.76 5952921000 $16.76 5952921100 $16.76 5952921200 $16.76 5952921300 $16.76 5952921400 $16.76 5952921500 $16.76 5952921600 $16.76 5952921700 $16.76 5952921800 $16.76 5952921900 $16.76 5952922000 $16.76 5952922100 $16.76 5952922200 $16.76 5952922300 $16.76 5952922400 $16.76 5952922500 $16.76 5952922600 $16.76 5952922700 $16.76 5952922800 $16.76 5952922900 $16.76 5952923000 $16.76 5952923100 $16.76 5952923200 $16.76 5952923300 $16.76 5952923400 $16.76 5952923500 $16.76 5952923600 $16.76 5952923700 $16.76 5952923800 $16.76 5952923900 $16.76 5952924000 $16.76 5952924100 $16.76 5952924200 $16.76 5952924300 $16.76 5952924400 $16.76 5952924500 $16.76 5952924600 $16.76 5952924700 $16.76 5952924800 $16.76 5952924900 $16.76 5952925000 $16.76 5952925100 $16.76 5952925200 $16.76 5952925300 $16.76 5952925400 $16.76 5952925500 $16.76 5952925600 $16.76 5952925700 $16.76 5952925800 $16.76 5952925900 $16.76 5952926000 $16.76 5952926100 $16.76 5952926200 $16.76 5952926300 $16.76 5952926400 $16.76 5952926500 $16.76 5952926600 $16.76 5952926700 $16.76 5952926800 $16.76 Page 157 of 189 City of Chula Vista Engineer's ReportPage 372 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5952926900 $16.76 5952927100 $16.76 5952930100 $16.76 5952930200 $16.76 5952930300 $16.76 5952930400 $16.76 5952930500 $16.76 5952930600 $16.76 5952930700 $16.76 5952930800 $16.76 5952930900 $16.76 5952931000 $16.76 5952931100 $16.76 5952931200 $16.76 5952931300 $16.76 5952931400 $16.76 5952931500 $16.76 5952931600 $16.76 5952931700 $16.76 5952931800 $16.76 5952931900 $16.76 5952932000 $16.76 5952932100 $16.76 5952932200 $16.76 5952932300 $16.76 5952932400 $16.76 5952932500 $16.76 5952932600 $16.76 5952932700 $16.76 5952932800 $16.76 5952932900 $16.76 5952933000 $16.76 5952933100 $16.76 5952933200 $16.76 5952933300 $16.76 5952933400 $16.76 5952933500 $16.76 5952933600 $16.76 5952933700 $16.76 5952933800 $16.76 5952933900 $16.76 5952934000 $16.76 5952934100 $16.76 5952934200 $16.76 5952934300 $16.76 5952934400 $16.76 5952934500 $16.76 5952934600 $16.76 5952934700 $16.76 5952934800 $16.76 5952934900 $16.76 5952935000 $16.76 5952935100 $16.76 5952935200 $16.76 5952935300 $16.76 5952935400 $16.76 5952935500 $16.76 5952935600 $16.76 5952935700 $16.76 5952935800 $16.76 5952935900 $16.76 5952936000 $16.76 5952936100 $16.76 5952936200 $16.76 5952936300 $16.76 5952936400 $16.76 5952936500 $16.76 5953000500 $4,465.90 5953000600 $558.22 5953000900 $2,036.80 5953001000 $13,815.12 5953800100 $16.76 5953800200 $16.76 5953800300 $16.76 5953800400 $16.76 5953800500 $16.76 5953800600 $16.76 5953800700 $16.76 5953800800 $16.76 5953800900 $16.76 5953801000 $16.76 5953801100 $16.76 5953801200 $16.76 5953801300 $16.76 5953801400 $16.76 5953801500 $16.76 5953801600 $16.76 5953801700 $16.76 5953801800 $16.76 5953801900 $16.76 5953802000 $16.76 5953802100 $16.76 5953802200 $16.76 5953802300 $16.76 5953802400 $16.76 5953802500 $16.76 5953802600 $16.76 5953802700 $16.76 5953802800 $16.76 5953802900 $16.76 5953803000 $16.76 5953803100 $16.76 5953803200 $16.76 5953803300 $16.76 5953803400 $16.76 5953803500 $16.76 5953803600 $16.76 5953803700 $16.76 5953803800 $16.76 5953803900 $16.76 5953804000 $16.76 5953804100 $16.76 5953804200 $16.76 5953804300 $16.76 5953804400 $16.76 5953804500 $16.76 5953804600 $16.76 5953804700 $16.76 5953804800 $16.76 5953804900 $16.76 5953805000 $16.76 5953805100 $16.76 5953810100 $16.76 5953810200 $16.76 5953810300 $16.76 5953810400 $16.76 5953810500 $16.76 5953810600 $16.76 5953810700 $16.76 5953810800 $16.76 5953810900 $16.76 5953811000 $16.76 5953811100 $16.76 5953811200 $16.76 5953811300 $16.76 5953811400 $16.76 5953811500 $16.76 5953811600 $16.76 5953811700 $16.76 5953811800 $16.76 5953811900 $16.76 Page 158 of 189 City of Chula Vista Engineer's ReportPage 373 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5953900100 $16.76 5953900200 $16.76 5953900300 $16.76 5953900400 $16.76 5953900500 $16.76 5953900600 $16.76 5953900700 $16.76 5953900800 $16.76 5953900900 $16.76 5953901000 $16.76 5953901100 $16.76 5953901200 $16.76 5953901300 $16.76 5953901400 $16.76 5953901500 $16.76 5953901600 $16.76 5953901700 $16.76 5953901800 $16.76 5953901900 $16.76 5953902000 $16.76 5953902100 $16.76 5953902200 $16.76 5953902300 $16.76 5953902400 $16.76 5953902500 $16.76 5953902600 $16.76 5953902700 $16.76 5953902800 $16.76 5953902900 $16.76 5953903000 $16.76 5953903100 $16.76 5953903200 $16.76 5953903300 $16.76 5953903400 $16.76 5953903500 $16.76 5953903600 $16.76 5953903700 $16.76 5953903800 $16.76 5954000100 $16.76 5954000200 $16.76 5954000300 $16.76 5954000400 $16.76 5954000500 $16.76 5954000600 $16.76 5954000700 $16.76 5954000800 $16.76 5954000900 $16.76 5954001000 $16.76 5954001100 $16.76 5954001200 $16.76 5954001300 $16.76 5954001400 $16.76 5954001500 $16.76 5954001600 $16.76 5954001700 $16.76 5954001800 $16.76 5954001900 $16.76 5954002000 $16.76 5954002100 $16.76 5954002200 $16.76 5954002300 $16.76 5954002400 $16.76 5954002500 $16.76 5954002600 $16.76 5954002700 $16.76 5954002800 $16.76 5954002900 $16.76 5954003000 $16.76 5954003100 $16.76 5954003200 $16.76 5954003300 $16.76 5954003400 $16.76 5954003500 $16.76 5954003600 $16.76 5954003700 $16.76 5954003800 $16.76 5954003900 $16.76 5954004000 $16.76 5954004100 $16.76 5954004200 $16.76 5954004300 $16.76 5954004400 $16.76 5954004500 $16.76 5954004600 $16.76 5954004700 $16.76 5954004800 $16.76 5954004900 $16.76 5954005000 $16.76 5954005100 $16.76 5954005200 $16.76 5954005300 $16.76 5954005400 $16.76 5954005500 $16.76 5954005600 $16.76 5954005700 $16.76 5954005800 $16.76 5954100201 $13.40 5954100202 $13.40 5954100203 $13.40 5954100204 $13.40 5954100205 $13.40 5954100206 $13.40 5954100207 $13.40 5954100208 $13.40 5954100209 $13.40 5954100210 $13.40 5954100211 $13.40 5954100212 $13.40 5954100213 $13.40 5954100214 $13.40 5954100215 $13.40 5954100216 $13.40 5954100217 $13.40 5954100218 $13.40 5954100219 $13.40 5954100220 $13.40 5954100221 $13.40 5954100222 $13.40 5954100223 $13.40 5954100224 $13.40 5954100225 $13.40 5954100301 $13.40 5954100302 $13.40 5954100303 $13.40 5954100304 $13.40 5954100305 $13.40 5954100306 $13.40 5954100307 $13.40 5954100308 $13.40 5954100309 $13.40 5954100310 $13.40 5954100311 $13.40 5954100312 $13.40 5954100313 $13.40 5954100314 $13.40 5954100315 $13.40 5954100316 $13.40 5954100317 $13.40 5954100318 $13.40 5954100319 $13.40 5954100320 $13.40 Page 159 of 189 City of Chula Vista Engineer's ReportPage 374 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954100321 $13.40 5954100322 $13.40 5954100401 $13.40 5954100402 $13.40 5954100403 $13.40 5954100404 $13.40 5954100405 $13.40 5954100406 $13.40 5954100407 $13.40 5954100408 $13.40 5954100409 $13.40 5954100410 $13.40 5954100411 $13.40 5954100412 $13.40 5954100413 $13.40 5954100414 $13.40 5954100415 $13.40 5954100416 $13.40 5954100417 $13.40 5954100418 $13.40 5954100501 $13.40 5954100502 $13.40 5954100503 $13.40 5954100504 $13.40 5954100505 $13.40 5954100506 $13.40 5954100507 $13.40 5954100508 $13.40 5954100509 $13.40 5954100510 $13.40 5954100511 $13.40 5954100512 $13.40 5954100513 $13.40 5954100514 $13.40 5954100515 $13.40 5954100516 $13.40 5954101101 $13.40 5954101102 $13.40 5954101103 $13.40 5954101104 $13.40 5954101105 $13.40 5954101106 $13.40 5954101107 $13.40 5954101108 $13.40 5954101109 $13.40 5954101110 $13.40 5954101111 $13.40 5954101112 $13.40 5954101113 $13.40 5954101114 $13.40 5954101115 $13.40 5954102001 $13.40 5954102002 $13.40 5954102003 $13.40 5954102004 $13.40 5954102005 $13.40 5954102006 $13.40 5954102007 $13.40 5954102008 $13.40 5954102009 $13.40 5954102010 $13.40 5954102011 $13.40 5954102012 $13.40 5954102013 $13.40 5954102014 $13.40 5954102015 $13.40 5954102016 $13.40 5954102017 $13.40 5954102301 $13.40 5954102302 $13.40 5954102303 $13.40 5954102304 $13.40 5954102305 $13.40 5954102306 $13.40 5954102307 $13.40 5954102308 $13.40 5954102309 $13.40 5954102310 $13.40 5954102311 $13.40 5954102312 $13.40 5954102313 $13.40 5954102314 $13.40 5954102315 $13.40 5954102316 $13.40 5954102401 $13.40 5954102402 $13.40 5954102403 $13.40 5954102404 $13.40 5954102405 $13.40 5954102406 $13.40 5954102407 $13.40 5954102408 $13.40 5954102409 $13.40 5954102410 $13.40 5954102411 $13.40 5954102412 $13.40 5954102413 $13.40 5954102414 $13.40 5954102415 $13.40 5954102416 $13.40 5954102417 $13.40 5954102418 $13.40 5954102419 $13.40 5954102601 $13.40 5954102602 $13.40 5954102603 $13.40 5954102604 $13.40 5954102605 $13.40 5954102606 $13.40 5954102607 $13.40 5954102608 $13.40 5954102609 $13.40 5954102610 $13.40 5954102611 $13.40 5954102612 $13.40 5954102613 $13.40 5954102614 $13.40 5954102615 $13.40 5954102616 $13.40 5954102617 $13.40 5954102618 $13.40 5954102619 $13.40 5954102620 $13.40 5954102621 $13.40 5954102622 $13.40 5954102623 $13.40 5954102624 $13.40 5954102625 $13.40 5954102626 $13.40 5954102627 $13.40 5954102628 $13.40 5954102629 $13.40 5954102630 $13.40 5954102631 $13.40 5954102632 $13.40 5954102633 $13.40 5954102634 $13.40 5954102635 $13.40 5954102636 $13.40 5954102637 $13.40 5954102638 $13.40 Page 160 of 189 City of Chula Vista Engineer's ReportPage 375 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954102639 $13.40 5954102801 $13.40 5954102802 $13.40 5954102803 $13.40 5954102804 $13.40 5954102805 $13.40 5954102806 $13.40 5954102807 $13.40 5954102808 $13.40 5954102809 $13.40 5954102810 $13.40 5954102811 $13.40 5954102812 $13.40 5954102813 $13.40 5954102814 $13.40 5954102815 $13.40 5954102816 $13.40 5954102817 $13.40 5954102818 $13.40 5954102819 $13.40 5954102820 $13.40 5954102821 $13.40 5954102822 $13.40 5954102823 $13.40 5954102824 $13.40 5954102825 $13.40 5954102826 $13.40 5954102827 $13.40 5954102828 $13.40 5954102829 $13.40 5954200201 $10.04 5954200202 $10.04 5954200203 $10.04 5954200204 $10.04 5954200205 $10.04 5954200206 $10.04 5954200301 $10.04 5954200302 $10.04 5954200303 $10.04 5954200304 $10.04 5954200305 $10.04 5954200306 $10.04 5954200307 $10.04 5954200308 $10.04 5954200309 $10.04 5954200310 $10.04 5954200311 $10.04 5954200312 $10.04 5954200313 $10.04 5954200314 $10.04 5954200315 $10.04 5954200316 $10.04 5954200317 $10.04 5954200318 $10.04 5954200401 $10.04 5954200402 $10.04 5954200403 $10.04 5954200404 $10.04 5954200405 $10.04 5954200406 $10.04 5954200407 $10.04 5954200408 $10.04 5954200409 $10.04 5954200410 $10.04 5954200411 $10.04 5954200412 $10.04 5954200413 $10.04 5954200414 $10.04 5954200415 $10.04 5954200501 $10.04 5954200502 $10.04 5954200503 $10.04 5954200504 $10.04 5954200505 $10.04 5954200506 $10.04 5954200507 $10.04 5954200508 $10.04 5954200509 $10.04 5954200510 $10.04 5954200511 $10.04 5954200512 $10.04 5954200513 $10.04 5954200514 $10.04 5954200515 $10.04 5954200601 $10.04 5954200602 $10.04 5954200603 $10.04 5954200604 $10.04 5954200605 $10.04 5954200606 $10.04 5954200607 $10.04 5954200608 $10.04 5954200609 $10.04 5954200610 $10.04 5954200611 $10.04 5954200612 $10.04 5954200701 $10.04 5954200702 $10.04 5954200703 $10.04 5954200704 $10.04 5954200705 $10.04 5954200706 $10.04 5954200707 $10.04 5954200708 $10.04 5954200709 $10.04 5954200710 $10.04 5954200711 $10.04 5954200712 $10.04 5954200713 $10.04 5954200714 $10.04 5954200715 $10.04 5954200716 $10.04 5954200717 $10.04 5954200718 $10.04 5954200801 $10.04 5954200802 $10.04 5954200803 $10.04 5954200804 $10.04 5954200805 $10.04 5954200806 $10.04 5954200807 $10.04 5954200808 $10.04 5954200809 $10.04 5954200810 $10.04 5954200811 $10.04 5954200812 $10.04 5954200813 $10.04 5954200814 $10.04 5954200815 $10.04 5954200901 $10.04 5954200902 $10.04 5954200903 $10.04 5954200904 $10.04 5954200905 $10.04 5954200906 $10.04 5954200907 $10.04 5954200908 $10.04 5954200909 $10.04 5954200910 $10.04 5954200911 $10.04 5954200912 $10.04 Page 161 of 189 City of Chula Vista Engineer's ReportPage 376 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-88 - ELMD Zone A Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954200913 $10.04 5954200914 $10.04 5954200915 $10.04 5954200916 $10.04 5954200917 $10.04 5954200918 $10.04 5954200919 $10.04 5954200920 $10.04 5954200921 $10.04 5954200922 $10.04 5954200923 $10.04 5954200924 $10.04 5954200925 $10.04 5954200926 $10.04 5954200927 $10.04 5954200928 $10.04 5954200929 $10.04 5954200930 $10.04 5954201001 $10.04 5954201002 $10.04 5954201003 $10.04 5954201004 $10.04 5954201005 $10.04 5954201006 $10.04 5954201007 $10.04 5954201008 $10.04 5954201009 $10.04 5954201010 $10.04 5954201011 $10.04 5954201012 $10.04 Totals Parcels 2,427 Levy $145,809.42 Page 162 of 189 City of Chula Vista Engineer's ReportPage 377 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5953203000 $3,457.10 5953211439 $27.46 5953211440 $27.46 5953211441 $27.46 5953211442 $27.46 5953211443 $27.46 5953211444 $27.46 5953211445 $27.46 5953211446 $27.46 5953211447 $27.46 5953211448 $27.46 5953211449 $27.46 5953211450 $27.46 5953211451 $27.46 5953211452 $27.46 5953211453 $27.46 5953211454 $27.46 5953211455 $27.46 5953211456 $27.46 5953211457 $27.46 5953211458 $27.46 5953211459 $27.46 5953211460 $27.46 5953211461 $27.46 5953211462 $27.46 5953211463 $27.46 5953211464 $27.46 5953211465 $27.46 5953211466 $27.46 5953211467 $27.46 5953211468 $27.46 5953211469 $27.46 5953211470 $27.46 5953211471 $27.46 5953211472 $27.46 5953212630 $21.96 5953212631 $21.96 5953212632 $21.96 5953212633 $21.96 5953212634 $21.96 5953212635 $21.96 5953212636 $21.96 5953212637 $21.96 5953212838 $21.96 5953212839 $21.96 5953212840 $21.96 5953212841 $21.96 5953212842 $21.96 5953212843 $21.96 5953212844 $21.96 5953212845 $21.96 5953212846 $21.96 5953212847 $21.96 5953212848 $21.96 5953212849 $21.96 5953212850 $21.96 5953212851 $21.96 5953212852 $21.96 5953212853 $21.96 5953212854 $21.96 5953212855 $21.96 5953212856 $21.96 5953212857 $21.96 5953212858 $21.96 5953212859 $21.96 5953212860 $21.96 5953212861 $21.96 5953212862 $21.96 5953212863 $21.96 5953212864 $21.96 5953212865 $21.96 5953212866 $21.96 5953212867 $21.96 5953212868 $21.96 5953212869 $21.96 5953212870 $21.96 5953212871 $21.96 5953212872 $21.96 5953212873 $21.96 5953212874 $21.96 5953212901 $21.96 5953212902 $21.96 5953212903 $21.96 5953212904 $21.96 5953212905 $21.96 5953212906 $21.96 5953212907 $21.96 5953212908 $21.96 5953212909 $21.96 5953212910 $21.96 5953212911 $21.96 5953212912 $21.96 5953212913 $21.96 5953212914 $21.96 5953212915 $21.96 5953212916 $21.96 5953212917 $21.96 5953212918 $21.96 5953212919 $21.96 5953212920 $21.96 5953212921 $21.96 5953212922 $21.96 5953212923 $21.96 5953212924 $21.96 5953212925 $21.96 5953212926 $21.96 5953212927 $21.96 5953212928 $21.96 5953212929 $21.96 5953212930 $21.96 5953212931 $21.96 5953213001 $21.96 5953213002 $21.96 5953213003 $21.96 5953213004 $21.96 5953213005 $21.96 5953213006 $21.96 5953213007 $21.96 5953213008 $21.96 5953213009 $21.96 5953213010 $21.96 5953213011 $21.96 5953213012 $21.96 5953213013 $21.96 5953213014 $21.96 5953213015 $21.96 5953213016 $21.96 5953213017 $21.96 5953213018 $21.96 5953213019 $21.96 5953213020 $21.96 5953213021 $21.96 5953213022 $21.96 5953213023 $21.96 5953213024 $21.96 5953213025 $21.96 5953213026 $21.96 5953213027 $21.96 5953213028 $21.96 5953213029 $21.96 5953213030 $21.96 Assessment Roll Page 163 of 189 City of Chula Vista Engineer's ReportPage 378 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5953213031 $21.96 5953213032 $21.96 5953213601 $27.46 5953213602 $27.46 5953213603 $27.46 5953213604 $27.46 5953213605 $27.46 5953213606 $27.46 5953213607 $27.46 5953213608 $27.46 5953213609 $27.46 5953213610 $27.46 5953213611 $27.46 5953213612 $27.46 5953213701 $27.46 5953213702 $27.46 5953213703 $27.46 5953213704 $27.46 5953213705 $27.46 5953213706 $27.46 5953213707 $27.46 5953213708 $27.46 5953213709 $27.46 5953213710 $27.46 5953213801 $27.46 5953213802 $27.46 5953213803 $27.46 5953213804 $27.46 5953213805 $27.46 5953213806 $27.46 5953213807 $27.46 5953213808 $27.46 5953213809 $27.46 5953213810 $27.46 5953213811 $27.46 5953213812 $27.46 5953213901 $27.46 5953213902 $27.46 5953213903 $27.46 5953213904 $27.46 5953213905 $27.46 5953213906 $27.46 5953213907 $27.46 5953213908 $27.46 5953213909 $27.46 5953213910 $27.46 5953213911 $27.46 5953213912 $27.46 5953214807 $27.46 5953214808 $27.46 5953214809 $27.46 5953214810 $27.46 5953214811 $27.46 5953214812 $27.46 5953214813 $27.46 5953214814 $27.46 5953214815 $27.46 5953214816 $27.46 5953214817 $27.46 5953214818 $27.46 5953214927 $27.46 5953214928 $27.46 5953214929 $27.46 5953214930 $27.46 5953214931 $27.46 5953214932 $27.46 5953214933 $27.46 5953214934 $27.46 5953214935 $27.46 5953214936 $27.46 5953214937 $27.46 5953214938 $27.46 5953215001 $27.46 5953215002 $27.46 5953215003 $27.46 5953215004 $27.46 5953215005 $27.46 5953215006 $27.46 5953215019 $27.46 5953215020 $27.46 5953215021 $27.46 5953215022 $27.46 5953215023 $27.46 5953215024 $27.46 5953215025 $27.46 5953215026 $27.46 5953215101 $27.46 5953215102 $27.46 5953215103 $27.46 5953215104 $27.46 5953215105 $27.46 5953215106 $27.46 5953215107 $27.46 5953215108 $27.46 5953215109 $27.46 5953215110 $27.46 5953215111 $27.46 5953215112 $27.46 5953215113 $27.46 5953215201 $27.46 5953215202 $27.46 5953215203 $27.46 5953215204 $27.46 5953215205 $27.46 5953215206 $27.46 5953215207 $27.46 5953215208 $27.46 5953215209 $27.46 5953215210 $27.46 5953215211 $27.46 5953215212 $27.46 5953215213 $27.46 5953215301 $27.46 5953215302 $27.46 5953215303 $27.46 5953215304 $27.46 5953215305 $27.46 5953215306 $27.46 5953215307 $27.46 5953215308 $27.46 5953215309 $27.46 5953215310 $27.46 5953215311 $27.46 5953215312 $27.46 5953215313 $27.46 5953215314 $27.46 5953215315 $27.46 5953215316 $27.46 5953215317 $27.46 5953215318 $27.46 5953215319 $27.46 5953215320 $27.46 5953215401 $27.46 5953215402 $27.46 5953215403 $27.46 5953215404 $27.46 5953215405 $27.46 5953215406 $27.46 5953215407 $27.46 5953215408 $27.46 5953215409 $27.46 Page 164 of 189 City of Chula Vista Engineer's ReportPage 379 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5953215410 $27.46 5953215411 $27.46 5953215701 $27.46 5953215702 $27.46 5953215703 $27.46 5953215704 $27.46 5953215705 $27.46 5953215706 $27.46 5953215707 $27.46 5953215708 $27.46 5953215709 $27.46 5953215710 $27.46 5953215711 $27.46 5953215712 $27.46 5953215713 $27.46 5953215714 $27.46 5953215715 $27.46 5953215716 $27.46 5953215717 $27.46 5953215718 $27.46 5953216001 $27.46 5953216002 $27.46 5953216003 $27.46 5953216004 $27.46 5953216005 $27.46 5953216006 $27.46 5953216007 $27.46 5953216008 $27.46 5953216009 $27.46 5953216010 $27.46 5953216011 $27.46 5953216119 $21.96 5953216120 $21.96 5953216121 $21.96 5953216122 $21.96 5953216123 $21.96 5953216124 $21.96 5953216125 $21.96 5953216126 $21.96 5953216127 $21.96 5953216128 $21.96 5953216129 $21.96 5953216301 $21.96 5953216302 $21.96 5953216303 $21.96 5953216304 $21.96 5953216305 $21.96 5953216306 $21.96 5953216307 $21.96 5953216308 $21.96 5953216313 $21.96 5953216314 $21.96 5953216315 $21.96 5953216316 $21.96 5953216317 $21.96 5953216318 $21.96 5953216409 $21.96 5953216410 $21.96 5953216411 $21.96 5953216412 $21.96 5953216501 $21.96 5953216502 $21.96 5953216503 $21.96 5953216504 $21.96 5953216505 $21.96 5953216506 $21.96 5953216507 $21.96 5953216508 $21.96 5953216509 $21.96 5953216510 $21.96 5953216511 $21.96 5953216601 $21.96 5953216602 $21.96 5953216603 $21.96 5953216604 $21.96 5953216605 $21.96 5953216606 $21.96 5953216607 $21.96 5953216608 $21.96 5953216609 $21.96 5953216610 $21.96 5953216801 $27.46 5953216802 $27.46 5953216803 $27.46 5953216804 $27.46 5953216805 $27.46 5953216806 $27.46 5953216807 $27.46 5953216808 $27.46 5953216809 $27.46 5953216810 $27.46 5953220100 $2,856.20 5953220200 $8,197.86 5953220300 $1,661.54 5953220800 $961.22 5953220900 $1,167.18 5953221000 $933.74 5953221100 $1,139.72 5953221200 $782.70 5953221600 $1,194.66 5953221800 $1,565.42 5953222100 $4,600.12 5953222200 $1,263.32 5953300100 $27.46 5953300200 $27.46 5953300300 $27.46 5953300400 $27.46 5953300500 $27.46 5953300600 $27.46 5953300700 $27.46 5953300800 $27.46 5953300900 $27.46 5953301000 $27.46 5953301100 $27.46 5953301200 $27.46 5953301300 $27.46 5953301400 $27.46 5953301500 $27.46 5953301600 $27.46 5953301700 $27.46 5953301800 $27.46 5953301900 $27.46 5953302000 $27.46 5953302100 $27.46 5953302200 $27.46 5953302300 $27.46 5953302400 $27.46 5953302500 $27.46 5953302600 $27.46 5953302700 $27.46 5953302800 $27.46 5953302900 $27.46 5953303000 $27.46 5953303100 $27.46 5953303200 $27.46 5953303300 $27.46 5953303400 $27.46 5953303500 $27.46 5953303600 $27.46 5953303700 $27.46 5953303800 $27.46 Page 165 of 189 City of Chula Vista Engineer's ReportPage 380 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5953303900 $27.46 5953304000 $27.46 5953304100 $27.46 5953304200 $27.46 5953304300 $27.46 5953304400 $27.46 5953304500 $27.46 5953304600 $27.46 5953304700 $27.46 5953310100 $27.46 5953310200 $27.46 5953310300 $27.46 5953310400 $27.46 5953310500 $27.46 5953310600 $27.46 5953310700 $27.46 5953310800 $27.46 5953310900 $27.46 5953311000 $27.46 5953311100 $27.46 5953311200 $27.46 5953311300 $27.46 5953311400 $27.46 5953311500 $27.46 5953311600 $27.46 5953311700 $27.46 5953311800 $27.46 5953311900 $27.46 5953312000 $27.46 5953312100 $27.46 5953312200 $27.46 5953312300 $27.46 5953312400 $27.46 5953312500 $27.46 5953312600 $27.46 5953312700 $27.46 5953312800 $27.46 5953312900 $27.46 5953313000 $27.46 5953313100 $27.46 5953313200 $27.46 5953313300 $27.46 5953313400 $27.46 5953313500 $27.46 5953313600 $27.46 5953313700 $27.46 5953313800 $27.46 5953313900 $27.46 5953314000 $27.46 5953314100 $27.46 5953314200 $27.46 5953314300 $27.46 5953314400 $27.46 5953314500 $27.46 5953314600 $27.46 5953314700 $27.46 5953314800 $27.46 5953314900 $27.46 5953315000 $27.46 5953315100 $27.46 5953315200 $27.46 5953315300 $27.46 5953315400 $27.46 5953315500 $27.46 5953315600 $27.46 5953315700 $27.46 5953315800 $27.46 5953400100 $32.94 5953400200 $32.94 5953400300 $32.94 5953400400 $32.94 5953400500 $32.94 5953400600 $32.94 5953400700 $32.94 5953400800 $32.94 5953400900 $32.94 5953401000 $32.94 5953401100 $32.94 5953401200 $32.94 5953401300 $32.94 5953401400 $32.94 5953401500 $32.94 5953401600 $32.94 5953401700 $32.94 5953401800 $32.94 5953410100 $32.94 5953410200 $32.94 5953410300 $32.94 5953410400 $32.94 5953410500 $32.94 5953410600 $32.94 5953410700 $32.94 5953410800 $32.94 5953410900 $32.94 5953411000 $32.94 5953411100 $32.94 5953411200 $32.94 5953411500 $32.94 5953411600 $32.94 5953411700 $32.94 5953411800 $32.94 5953411900 $32.94 5953412000 $32.94 5953412100 $32.94 5953412200 $32.94 5953412300 $32.94 5953500100 $27.46 5953500200 $27.46 5953500300 $27.46 5953500400 $27.46 5953500500 $27.46 5953500600 $27.46 5953500700 $27.46 5953500800 $27.46 5953500900 $27.46 5953501000 $27.46 5953501100 $27.46 5953501200 $27.46 5953501300 $27.46 5953501400 $27.46 5953501500 $27.46 5953501600 $27.46 5953501700 $27.46 5953501800 $27.46 5953501900 $27.46 5953502000 $27.46 5953502100 $27.46 5953502200 $27.46 5953502300 $27.46 5953502400 $27.46 5953502500 $27.46 5953502600 $27.46 5953502700 $27.46 5953502800 $27.46 5953502900 $27.46 5953503000 $27.46 5953503100 $27.46 5953503200 $27.46 5953503300 $27.46 5953503400 $27.46 5953503500 $27.46 Page 166 of 189 City of Chula Vista Engineer's ReportPage 381 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5953503600 $27.46 5953503700 $27.46 5953503800 $27.46 5953503900 $27.46 5953504000 $27.46 5953504100 $27.46 5953504200 $27.46 5953504300 $27.46 5953504400 $27.46 5953504500 $27.46 5953504600 $27.46 5953504700 $27.46 5953504800 $27.46 5953504900 $27.46 5953505000 $27.46 5953505100 $27.46 5953505200 $27.46 5953505300 $27.46 5953505400 $27.46 5953505500 $27.46 5953505600 $27.46 5953505700 $27.46 5953505800 $27.46 5953505900 $27.46 5953506000 $27.46 5953600100 $27.46 5953600200 $27.46 5953600300 $27.46 5953600400 $27.46 5953600500 $27.46 5953600600 $27.46 5953600700 $27.46 5953600800 $27.46 5953600900 $27.46 5953601000 $27.46 5953601100 $27.46 5953601200 $27.46 5953601300 $27.46 5953601400 $27.46 5953601500 $27.46 5953601600 $27.46 5953601700 $27.46 5953601800 $27.46 5953601900 $27.46 5953602000 $27.46 5953602100 $27.46 5953602200 $27.46 5953602300 $27.46 5953602400 $27.46 5953602500 $27.46 5953602600 $27.46 5953602700 $27.46 5953602800 $27.46 5953602900 $27.46 5953603000 $27.46 5953603100 $27.46 5953603200 $27.46 5953603300 $27.46 5953603400 $27.46 5953603500 $27.46 5953603600 $27.46 5953603700 $27.46 5953603800 $27.46 5953603900 $27.46 5953604000 $27.46 5953604100 $27.46 5953604200 $27.46 5953604300 $27.46 5953604400 $27.46 5953604500 $27.46 5953604600 $27.46 5953604700 $27.46 5953604800 $27.46 5953604900 $27.46 5953605000 $27.46 5953605100 $27.46 5953605200 $27.46 5953605300 $27.46 5953605400 $27.46 5953605500 $27.46 5953605600 $27.46 5953605700 $27.46 5953605800 $27.46 5953605900 $27.46 5953606000 $27.46 5953606100 $27.46 5953606200 $27.46 5953606300 $27.46 5953606400 $27.46 5953606500 $27.46 5953606600 $27.46 5953606700 $27.46 5953606800 $27.46 5953606900 $27.46 5953607000 $27.46 5953607100 $27.46 5953610100 $27.46 5953610200 $27.46 5953610300 $27.46 5953610400 $27.46 5953610500 $27.46 5953610600 $27.46 5953610700 $27.46 5953610800 $27.46 5953610900 $27.46 5953611000 $27.46 5953611100 $27.46 5953611200 $27.46 5953611300 $27.46 5953611400 $27.46 5953611500 $27.46 5953611600 $27.46 5953611700 $27.46 5953611800 $27.46 5953611900 $27.46 5953612000 $27.46 5953612100 $27.46 5953612200 $27.46 5953612300 $27.46 5953612400 $27.46 5953612500 $27.46 5953612600 $27.46 5953612700 $27.46 5953612800 $27.46 5953612900 $27.46 5953613000 $27.46 5953613100 $27.46 5953613200 $27.46 5953613300 $27.46 5953613400 $27.46 5953613500 $27.46 5953613600 $27.46 5953613700 $27.46 5953613800 $27.46 5953613900 $27.46 5953614000 $27.46 5953614100 $27.46 5953614200 $27.46 5953614300 $27.46 5953614400 $27.46 5953614500 $27.46 Page 167 of 189 City of Chula Vista Engineer's ReportPage 382 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5953614600 $27.46 5953614700 $27.46 5953614800 $27.46 5953614900 $27.46 5953615000 $27.46 5953615100 $27.46 5953615200 $27.46 5953615300 $27.46 5953615400 $27.46 5953615500 $27.46 5953615600 $27.46 5953615700 $27.46 5953615800 $27.46 5953615900 $27.46 5953616000 $27.46 5953616100 $27.46 5953616200 $27.46 5953616300 $27.46 5953616400 $27.46 5953616500 $27.46 5953616600 $27.46 5953616700 $27.46 5953616800 $27.46 5953616900 $27.46 5953617000 $27.46 5953617100 $27.46 5953700100 $27.46 5953700200 $27.46 5953700300 $27.46 5953700400 $27.46 5953700500 $27.46 5953700600 $27.46 5953700700 $27.46 5953700800 $27.46 5953700900 $27.46 5953701000 $27.46 5953701100 $27.46 5953701200 $27.46 5953701300 $27.46 5953701400 $27.46 5953701500 $27.46 5953701600 $27.46 5953701800 $27.46 5953701900 $27.46 5953702000 $27.46 5953702100 $27.46 5953702700 $27.46 5953702800 $27.46 5953702900 $27.46 5953703000 $27.46 5953703100 $27.46 5953703200 $27.46 5953703300 $27.46 5953703400 $27.46 5953703500 $27.46 5953703600 $27.46 5953703700 $27.46 5953704200 $27.46 5953704300 $27.46 5953704400 $27.46 5953704500 $27.46 5953704600 $27.46 5953704700 $27.46 5953704800 $27.46 5953705500 $27.46 5953705700 $27.46 5953705800 $27.46 5953705900 $27.46 5953706000 $27.46 5953706200 $27.46 5953706300 $27.46 5953706400 $27.46 5953706500 $27.46 5953706700 $27.46 5953710100 $27.46 5953710200 $27.46 5953710300 $27.46 5953710400 $27.46 5953710500 $27.46 5953710600 $27.46 5953710700 $27.46 5953710800 $27.46 5953710900 $27.46 5953711000 $27.46 5953711100 $27.46 5953711200 $27.46 5953711300 $27.46 5953711400 $27.46 5953711500 $27.46 5953711600 $27.46 5953711700 $27.46 5953711800 $27.46 5953711900 $27.46 5953712000 $27.46 5953712100 $27.46 5953712200 $27.46 5953712300 $27.46 5953712400 $27.46 5953712500 $27.46 5953712600 $27.46 5953712700 $27.46 5953712800 $27.46 5953712900 $27.46 5953713000 $27.46 5953713100 $27.46 5953713200 $27.46 5953713300 $27.46 5953713400 $27.46 5953713500 $27.46 5953713600 $27.46 5953713700 $27.46 5953713800 $27.46 5953713900 $27.46 5954300101 $21.96 5954300102 $21.96 5954300103 $21.96 5954300104 $21.96 5954300105 $21.96 5954300401 $21.96 5954300402 $21.96 5954300403 $21.96 5954300404 $21.96 5954300405 $21.96 5954300406 $21.96 5954300407 $21.96 5954300408 $21.96 5954300409 $21.96 5954300410 $21.96 5954300411 $21.96 5954300501 $21.96 5954300502 $21.96 5954300503 $21.96 5954300504 $21.96 5954300505 $21.96 5954300506 $21.96 5954301701 $21.96 5954301702 $21.96 5954301703 $21.96 5954301704 $21.96 5954301705 $21.96 5954301706 $21.96 Page 168 of 189 City of Chula Vista Engineer's ReportPage 383 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954301707 $21.96 5954301708 $21.96 5954301709 $21.96 5954301710 $21.96 5954301801 $21.96 5954301802 $21.96 5954301803 $21.96 5954301804 $21.96 5954301805 $21.96 5954301806 $21.96 5954301807 $21.96 5954301808 $21.96 5954301809 $21.96 5954301810 $21.96 5954301811 $21.96 5954301812 $21.96 5954301813 $21.96 5954301814 $21.96 5954400100 $27.46 5954400200 $27.46 5954400300 $27.46 5954400400 $27.46 5954400500 $27.46 5954400600 $27.46 5954400700 $27.46 5954400800 $27.46 5954400900 $27.46 5954401000 $27.46 5954401100 $27.46 5954401200 $27.46 5954401300 $27.46 5954401400 $27.46 5954401500 $27.46 5954401600 $27.46 5954401700 $27.46 5954401800 $27.46 5954401900 $27.46 5954402000 $27.46 5954402100 $27.46 5954402200 $27.46 5954402300 $27.46 5954402400 $27.46 5954402500 $27.46 5954402600 $27.46 5954402700 $27.46 5954402800 $27.46 5954402900 $27.46 5954403000 $27.46 5954403100 $27.46 5954403200 $27.46 5954403300 $27.46 5954403400 $27.46 5954403500 $27.46 5954403600 $27.46 5954403700 $27.46 5954403800 $27.46 5954403900 $27.46 5954404000 $27.46 5954404100 $27.46 5954404200 $27.46 5954404300 $27.46 5954404400 $27.46 5954404500 $27.46 5954404600 $27.46 5954404700 $27.46 5954404800 $27.46 5954404900 $27.46 5954405000 $27.46 5954405100 $27.46 5954405200 $27.46 5954405300 $27.46 5954405400 $27.46 5954405500 $27.46 5954405600 $27.46 5954405700 $27.46 5954405800 $27.46 5954405900 $27.46 5954406000 $27.46 5954406100 $27.46 5954406200 $27.46 5954406300 $27.46 5954406400 $27.46 5954406500 $27.46 5954406600 $27.46 5954406700 $27.46 5954406800 $27.46 5954406900 $27.46 5954407000 $27.46 5954407100 $27.46 5954407200 $27.46 5954407300 $27.46 5954407400 $27.46 5954407500 $27.46 5954407600 $27.46 5954407700 $27.46 5954407800 $27.46 5954407900 $27.46 5954408000 $27.46 5954408100 $27.46 5954408200 $27.46 5954408300 $27.46 5954408400 $27.46 5954408500 $27.46 5954408600 $27.46 5955000101 $27.46 5955000102 $27.46 5955000103 $27.46 5955000104 $27.46 5955000105 $27.46 5955000106 $27.46 5955000107 $27.46 5955000108 $27.46 5955000109 $27.46 5955000110 $27.46 5955000111 $27.46 5955000112 $27.46 5955000201 $27.46 5955000202 $27.46 5955000203 $27.46 5955000204 $27.46 5955000205 $27.46 5955000206 $27.46 5955000207 $27.46 5955000208 $27.46 5955000209 $27.46 5955000210 $27.46 5955000211 $27.46 5955000212 $27.46 5955000213 $27.46 5955000214 $27.46 5955000215 $27.46 5955000216 $27.46 5955000217 $27.46 5955000218 $27.46 5955000301 $27.46 5955000302 $27.46 5955000303 $27.46 5955000304 $27.46 5955000305 $27.46 5955000306 $27.46 5955000307 $27.46 Page 169 of 189 City of Chula Vista Engineer's ReportPage 384 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5955000308 $27.46 5955000309 $27.46 5955000310 $27.46 5955000311 $27.46 5955000312 $27.46 5955000401 $27.46 5955000402 $27.46 5955000403 $27.46 5955000404 $27.46 5955000405 $27.46 5955000406 $27.46 5955000407 $27.46 5955000408 $27.46 5955000409 $27.46 5955100101 $21.96 5955100102 $21.96 5955100103 $21.96 5955100104 $21.96 5955100105 $21.96 5955100106 $21.96 5955100107 $21.96 5955100108 $21.96 5955100109 $21.96 5955100110 $21.96 5955100111 $21.96 5955100112 $21.96 5955100113 $21.96 5955100114 $21.96 5955100115 $21.96 5955100116 $21.96 5955100117 $21.96 5955100201 $21.96 5955100202 $21.96 5955100203 $21.96 5955100204 $21.96 5955100205 $21.96 5955100206 $21.96 5955100207 $21.96 5955100208 $21.96 5955100209 $21.96 5955100210 $21.96 5955100211 $21.96 5955100212 $21.96 5955100213 $21.96 5955100214 $21.96 5955100215 $21.96 5955100216 $21.96 5955100217 $21.96 5955100218 $21.96 5955100301 $21.96 5955100302 $21.96 5955100303 $21.96 5955100304 $21.96 5955100305 $21.96 5955100306 $21.96 5955100307 $21.96 5955100308 $21.96 5955100309 $21.96 5955100310 $21.96 5955100311 $21.96 5955100312 $21.96 5955100313 $21.96 5955100314 $21.96 5955100315 $21.96 5955100316 $21.96 5955100401 $21.96 5955100402 $21.96 5955100403 $21.96 5955100404 $21.96 5955100405 $21.96 5955100406 $21.96 5955100407 $21.96 5955100408 $21.96 5955100409 $21.96 5955100410 $21.96 5955100501 $21.96 5955100502 $21.96 5955100503 $21.96 5955100504 $21.96 5955100505 $21.96 5955100506 $21.96 5955100507 $21.96 5955100508 $21.96 5955100509 $21.96 5955100510 $21.96 5955100511 $21.96 5955100512 $21.96 5955100513 $21.96 5955100514 $21.96 5955100515 $21.96 5955100516 $21.96 5955100601 $21.96 5955100602 $21.96 5955100603 $21.96 5955100604 $21.96 5955100605 $21.96 5955100606 $21.96 5955100607 $21.96 5955100608 $21.96 5955100609 $21.96 5955100610 $21.96 5955100611 $21.96 5955100612 $21.96 5955100613 $21.96 5955100614 $21.96 5955100615 $21.96 5955100616 $21.96 5955100701 $21.96 5955100702 $21.96 5955100703 $21.96 5955100704 $21.96 5955100705 $21.96 5955100706 $21.96 5955100707 $21.96 5955100708 $21.96 5955100709 $21.96 5955100801 $21.96 5955100802 $21.96 5955100803 $21.96 5955100804 $21.96 5955100805 $21.96 5955100806 $21.96 5955100807 $21.96 5955100808 $21.96 5955100809 $21.96 5955100810 $21.96 5955100811 $21.96 5955100812 $21.96 5955100813 $21.96 5955100814 $21.96 5955100815 $21.96 5955100816 $21.96 5955100817 $21.96 5955100901 $21.96 5955100902 $21.96 5955100903 $21.96 5955100904 $21.96 5955100905 $21.96 5955100906 $21.96 5955100907 $21.96 5955100908 $21.96 Page 170 of 189 City of Chula Vista Engineer's ReportPage 385 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5955100909 $21.96 5955100910 $21.96 5955100911 $21.96 5955100912 $21.96 5955100913 $21.96 5955100914 $21.96 5955100915 $21.96 5955100916 $21.96 6430900100 $27.46 6430900200 $27.46 6430900300 $27.46 6430900400 $27.46 6430900500 $27.46 6430900600 $27.46 6430900700 $27.46 6430900800 $27.46 6430900900 $27.46 6430901000 $27.46 6430901100 $27.46 6430901200 $27.46 6430901300 $27.46 6430901400 $27.46 6430901500 $27.46 6430901600 $27.46 6430901700 $27.46 6430901800 $27.46 6430901900 $27.46 6430902000 $27.46 6430902100 $27.46 6430902200 $27.46 6430902300 $27.46 6430902400 $27.46 6430902500 $27.46 6430902600 $27.46 6430902700 $27.46 6430902800 $27.46 6430902900 $27.46 6430903000 $27.46 6430903100 $27.46 6430903200 $27.46 6430903300 $27.46 6430903400 $27.46 6430903500 $27.46 6430903600 $27.46 6430903700 $27.46 6430903800 $27.46 6430903900 $27.46 6430904000 $27.46 6430904100 $27.46 6430904200 $27.46 6430904300 $27.46 6430904400 $27.46 6430904500 $27.46 6430904600 $27.46 6430904700 $27.46 6430904800 $27.46 6430910100 $27.46 6430910200 $27.46 6430910300 $27.46 6430910400 $27.46 6430910500 $27.46 6430910600 $27.46 6430910700 $27.46 6430910800 $27.46 6430910900 $27.46 6430911000 $27.46 6430911100 $27.46 6430911200 $27.46 6430911300 $27.46 6430911400 $27.46 6430911500 $27.46 6430911600 $27.46 6430911700 $27.46 6430911800 $27.46 6430911900 $27.46 6430912000 $27.46 6430912100 $27.46 6430912200 $27.46 6430912300 $27.46 6430912400 $27.46 6430912500 $27.46 6430912600 $27.46 6430912700 $27.46 6430912800 $27.46 6430912900 $27.46 6430913000 $27.46 6430913100 $27.46 6430913200 $27.46 6430913300 $27.46 6430913400 $27.46 6430913500 $27.46 6430913600 $27.46 6430913700 $27.46 6430913800 $27.46 6430913900 $27.46 6430914000 $27.46 6430914100 $27.46 6430914200 $27.46 6430914300 $27.46 6430914400 $27.46 6430914500 $27.46 6430914600 $27.46 6430914700 $27.46 6430914800 $27.46 6431000501 $21.96 6431000502 $21.96 6431000503 $21.96 6431000504 $21.96 6431000505 $21.96 6431000801 $21.96 6431000802 $21.96 6431000803 $21.96 6431000804 $21.96 6431000805 $21.96 6431000806 $21.96 6431000807 $21.96 6431000808 $21.96 6431000809 $21.96 6431000810 $21.96 6431002001 $21.96 6431002002 $21.96 6431002003 $21.96 6431002004 $21.96 6431002005 $21.96 6431002006 $21.96 6431002007 $21.96 6431002008 $21.96 6431002009 $21.96 6431002010 $21.96 6431002011 $21.96 6431002012 $21.96 6431002013 $21.96 6431002014 $21.96 6431002015 $21.96 6431002016 $21.96 6431002017 $21.96 6431002018 $21.96 6431002019 $21.96 6431002020 $21.96 6431002101 $21.96 6431002102 $21.96 Page 171 of 189 City of Chula Vista Engineer's ReportPage 386 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6431002103 $21.96 6431002104 $21.96 6431002105 $21.96 6431002106 $21.96 6431002107 $21.96 6431002108 $21.96 6431002109 $21.96 6431002110 $21.96 6431002111 $21.96 6431002112 $21.96 6431002113 $21.96 6431002114 $21.96 6431002115 $21.96 6431002116 $21.96 6431002117 $21.96 6431002118 $21.96 6431002201 $21.96 6431002202 $21.96 6431002203 $21.96 6431002204 $21.96 6431002205 $21.96 6431002206 $21.96 6431002207 $21.96 6431002208 $21.96 6431002209 $21.96 6431002301 $27.46 6431002302 $27.46 6431002303 $27.46 6431002304 $27.46 6431002305 $27.46 6431002306 $27.46 6431002307 $27.46 6431002308 $27.46 6431002309 $27.46 6431002310 $27.46 6431002311 $21.96 6431002312 $21.96 6431002313 $21.96 6431002314 $21.96 6431002315 $21.96 6431002316 $21.96 6431100100 $27.46 6431100200 $27.46 6431100300 $27.46 6431100400 $27.46 6431100500 $27.46 6431100600 $27.46 6431100700 $27.46 6431100800 $27.46 6431100900 $27.46 6431101000 $27.46 6431101100 $27.46 6431101200 $27.46 6431101300 $27.46 6431101400 $27.46 6431101500 $27.46 6431101600 $27.46 6431101700 $27.46 6431101800 $27.46 6431101900 $27.46 6431102000 $27.46 6431102100 $27.46 6431102200 $27.46 6431102300 $27.46 6431102400 $27.46 6431102500 $27.46 6431102600 $27.46 6431102700 $27.46 6431102800 $27.46 6431102900 $27.46 6431103000 $27.46 6431103100 $27.46 6431103200 $27.46 6431103300 $27.46 6431103400 $27.46 6431103500 $27.46 6431103600 $27.46 6431103700 $27.46 6431103800 $27.46 6431103900 $27.46 6431104000 $27.46 6431104100 $27.46 6431104200 $27.46 6431104300 $27.46 6431104400 $27.46 6431104500 $27.46 6431104600 $27.46 6431104700 $27.46 6431104800 $27.46 6431104900 $27.46 6431105000 $27.46 6431105100 $27.46 6431300100 $27.46 6431300200 $27.46 6431300300 $27.46 6431300400 $27.46 6431300500 $27.46 6431300600 $27.46 6431300700 $27.46 6431300800 $27.46 6431300900 $27.46 6431301000 $27.46 6431301100 $27.46 6431301200 $27.46 6431301300 $27.46 6431301400 $27.46 6431301500 $27.46 6431301600 $27.46 6431301700 $27.46 6431301800 $27.46 6431301900 $27.46 6431302000 $27.46 6431302100 $27.46 6431302200 $27.46 6431302300 $27.46 6431302400 $27.46 6431302500 $27.46 6431302600 $27.46 6431302700 $27.46 6431302800 $27.46 6431302900 $27.46 6431303000 $27.46 6431303100 $27.46 6431303200 $27.46 6431303300 $27.46 6431303400 $27.46 6431303500 $27.46 6431303600 $27.46 6431303700 $27.46 6431303800 $27.46 6431303900 $27.46 6431304000 $27.46 6431304100 $27.46 6431304200 $27.46 6431304300 $27.46 6431304400 $27.46 6431304500 $27.46 6431304600 $27.46 6431304700 $27.46 6431304800 $27.46 6431304900 $27.46 Page 172 of 189 City of Chula Vista Engineer's ReportPage 387 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6431305000 $27.46 6431305100 $27.46 6431305200 $27.46 6431305300 $27.46 6431305400 $27.46 6431305500 $27.46 6431305600 $27.46 6431305700 $27.46 6431305800 $27.46 6431305900 $27.46 6431306000 $27.46 6431306100 $27.46 6431306200 $27.46 6431306300 $27.46 6431306400 $27.46 6431306500 $27.46 6431306600 $27.46 6431306700 $27.46 6431306800 $27.46 6431310100 $27.46 6431310200 $27.46 6431310300 $27.46 6431310400 $27.46 6431310500 $27.46 6431310600 $27.46 6431310700 $27.46 6431310800 $27.46 6431310900 $27.46 6431311000 $27.46 6431311100 $27.46 6431311200 $27.46 6431311300 $27.46 6431311400 $27.46 6431311500 $27.46 6431311600 $27.46 6431311700 $27.46 6431311800 $27.46 6431311900 $27.46 6431312000 $27.46 6431312100 $27.46 6431312200 $27.46 6431312300 $27.46 6431312400 $27.46 6431312500 $27.46 6431313000 $27.46 6431313100 $27.46 6431313200 $27.46 6431313300 $27.46 6431313400 $27.46 6431313500 $27.46 6431313600 $27.46 6431313700 $27.46 6431313800 $27.46 6431313900 $27.46 6431314000 $27.46 6431314100 $27.46 6431314200 $27.46 6431314300 $27.46 6431314400 $27.46 6431314500 $27.46 6431400400 $27.46 6431400500 $27.46 6431400600 $27.46 6431400700 $27.46 6431400800 $27.46 6431400900 $27.46 6431401000 $27.46 6431401100 $27.46 6431401200 $27.46 6431401300 $27.46 6431401400 $27.46 6431401500 $27.46 6431401600 $27.46 6431401700 $27.46 6431401800 $27.46 6431401900 $27.46 6431402000 $27.46 6431402100 $27.46 6431402200 $27.46 6431402300 $27.46 6431402400 $27.46 6431402500 $27.46 6431402600 $27.46 6431402700 $27.46 6431402800 $27.46 6431402900 $27.46 6431403000 $27.46 6431403100 $27.46 6431403200 $27.46 6431403300 $27.46 6431403400 $27.46 6431404600 $27.46 6431404700 $27.46 6431404800 $27.46 6431410100 $27.46 6431410200 $27.46 6431410300 $27.46 6431410400 $27.46 6431410500 $27.46 6431410600 $27.46 6431410700 $27.46 6431410800 $27.46 6431410900 $27.46 6431411000 $27.46 6431411100 $27.46 6431411200 $27.46 6431411300 $27.46 6431411400 $27.46 6431411500 $27.46 6431411600 $27.46 6431411700 $27.46 6431411800 $27.46 6431411900 $27.46 6431412000 $27.46 6431412100 $27.46 6431412200 $27.46 6431412300 $27.46 6431412400 $27.46 6431412500 $27.46 6431412600 $27.46 6431412700 $27.46 6431412800 $27.46 6431412900 $27.46 6431413000 $27.46 6431500100 $27.46 6431500200 $27.46 6431500300 $27.46 6431500400 $27.46 6431500500 $27.46 6431500600 $27.46 6431500700 $27.46 6431500800 $27.46 6431500900 $27.46 6431501000 $27.46 6431501100 $27.46 6431501200 $27.46 6431501300 $27.46 6431501400 $27.46 6431501500 $27.46 6431501600 $27.46 6431501700 $27.46 Page 173 of 189 City of Chula Vista Engineer's ReportPage 388 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6431501800 $27.46 6431501900 $27.46 6431502000 $27.46 6431502100 $27.46 6431502200 $27.46 6431502300 $27.46 6431502400 $27.46 6431502500 $27.46 6431502600 $27.46 6431502700 $27.46 6431502800 $27.46 6431502900 $27.46 6431503000 $27.46 6431503100 $27.46 6431503200 $27.46 6431503300 $27.46 6431503400 $27.46 6431503500 $27.46 6431503600 $27.46 6431503700 $27.46 6431503800 $27.46 6431503900 $27.46 6431504000 $27.46 6431600100 $27.46 6431600200 $27.46 6431600300 $27.46 6431600400 $27.46 6431600500 $27.46 6431600600 $27.46 6431600700 $27.46 6431600800 $27.46 6431600900 $27.46 6431601000 $27.46 6431601100 $27.46 6431601200 $27.46 6431601300 $27.46 6431601400 $27.46 6431601500 $27.46 6431601600 $27.46 6431601700 $27.46 6431601800 $27.46 6431601900 $27.46 6431602000 $27.46 6431602100 $27.46 6431602200 $27.46 6431602300 $27.46 6431602400 $27.46 6431602500 $27.46 6431602600 $27.46 6431602700 $27.46 6431602800 $27.46 6431602900 $27.46 6431603000 $27.46 6431603100 $27.46 6431603200 $27.46 6431603300 $27.46 6431603400 $27.46 6431603500 $27.46 6431603600 $27.46 6431603700 $27.46 6431603800 $27.46 6431603900 $27.46 6431604000 $27.46 6431610100 $27.46 6431610200 $27.46 6431610300 $27.46 6431610400 $27.46 6431610500 $27.46 6431610600 $27.46 6431610700 $27.46 6431610800 $27.46 6431610900 $27.46 6431611000 $27.46 6431611100 $27.46 6431611200 $27.46 6431611300 $27.46 6431611400 $27.46 6431611500 $27.46 6431611600 $27.46 6431611700 $27.46 6431611800 $27.46 6431611900 $27.46 6431612000 $27.46 6431612100 $27.46 6431612200 $27.46 6431612300 $27.46 6431612400 $27.46 6431612500 $27.46 6431612600 $27.46 6431612700 $27.46 6431612800 $27.46 6431612900 $27.46 6431613000 $27.46 6431613100 $27.46 6431613200 $27.46 6431613300 $27.46 6431613400 $27.46 6431613500 $27.46 6431613600 $27.46 6431613700 $27.46 6431613800 $27.46 6431613900 $27.46 6431614000 $27.46 6431614100 $27.46 6431614200 $27.46 6431614300 $27.46 6431614400 $27.46 6431614500 $27.46 6431614600 $27.46 6431614700 $27.46 6431614800 $27.46 6431614900 $27.46 6431615000 $27.46 6431615100 $27.46 6431615200 $27.46 6431802200 $27.46 6431802300 $27.46 6431802400 $27.46 6431802500 $27.46 6431802600 $27.46 6431802700 $27.46 6431802800 $27.46 6431802900 $27.46 6431803000 $27.46 6431803100 $27.46 6431803200 $27.46 6431803300 $27.46 6431803400 $27.46 6431803500 $27.46 6431803600 $27.46 6431803700 $27.46 6431803800 $27.46 6431803900 $27.46 6431804000 $27.46 6431804100 $27.46 6431804200 $27.46 6431804300 $27.46 6431804400 $27.46 6431804500 $27.46 6431804600 $27.46 6431804700 $27.46 Page 174 of 189 City of Chula Vista Engineer's ReportPage 389 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6431804800 $27.46 6431804900 $27.46 6431805000 $27.46 6431805100 $27.46 6431805200 $27.46 6431805300 $27.46 6431805400 $27.46 6431805500 $27.46 6431805600 $27.46 6431808000 $27.46 6431808100 $27.46 6431808200 $27.46 6431808300 $27.46 6431808400 $27.46 6431808500 $27.46 6431808600 $27.46 6431810100 $27.46 6431810200 $27.46 6431810300 $27.46 6431810400 $27.46 6431810500 $27.46 6431810600 $27.46 6431810700 $27.46 6431810800 $27.46 6431810900 $27.46 6431811000 $27.46 6431811100 $27.46 6431811200 $27.46 6431811300 $27.46 6431811400 $27.46 6431811500 $27.46 6431811800 $27.46 6431811900 $27.46 6431812000 $27.46 6431812100 $27.46 6431812200 $27.46 6431812300 $27.46 6431812400 $27.46 6431812800 $27.46 6431813200 $27.46 6431813300 $27.46 6431813400 $27.46 6431813500 $27.46 6431813600 $27.46 6431820100 $27.46 6431820200 $27.46 6431820300 $27.46 6431820400 $27.46 6431820500 $27.46 6431820600 $27.46 6431820700 $27.46 6431820800 $27.46 6431820900 $27.46 6431821000 $27.46 6431821100 $27.46 6431821200 $27.46 6431821300 $27.46 6431821400 $27.46 6431821500 $27.46 6431821600 $27.46 6431821700 $27.46 6431821800 $27.46 6431821900 $27.46 6431822000 $27.46 6431822100 $27.46 6431822200 $27.46 6431822300 $27.46 6431822400 $27.46 6431822500 $27.46 6431822600 $27.46 6431822700 $27.46 6431822800 $27.46 6431822900 $27.46 6431823000 $27.46 6431823100 $27.46 6431823200 $27.46 6431823300 $27.46 6431823400 $27.46 6431823500 $27.46 6431823600 $27.46 6431823700 $27.46 6431823800 $27.46 6431823900 $27.46 6431824000 $27.46 6431824100 $27.46 6431824200 $27.46 6431824300 $27.46 6431900100 $27.46 6431900200 $27.46 6431900300 $27.46 6431900400 $27.46 6431900500 $27.46 6431900600 $27.46 6431900700 $27.46 6431900800 $27.46 6431900900 $27.46 6431901000 $27.46 6431901100 $27.46 6431901200 $27.46 6431901300 $27.46 6431901400 $27.46 6431901500 $27.46 6431901600 $27.46 6431901700 $27.46 6431901800 $27.46 6431901900 $27.46 6431902000 $27.46 6431902100 $27.46 6431902200 $27.46 6431902300 $27.46 6431902400 $27.46 6431902500 $27.46 6431902600 $27.46 6431902700 $27.46 6431902800 $27.46 6431902900 $27.46 6431903000 $27.46 6431903100 $27.46 6431903200 $27.46 6431903300 $27.46 6431903400 $27.46 6431903500 $27.46 6431903600 $27.46 6431903700 $27.46 6431903800 $27.46 6431903900 $27.46 6431904000 $27.46 6431904100 $27.46 6431904200 $27.46 6431904300 $27.46 6431904400 $27.46 6431904500 $27.46 6431904600 $27.46 6431904700 $27.46 6431904800 $27.46 6431904900 $27.46 6431905000 $27.46 6431905100 $27.46 6431905200 $27.46 6431905300 $27.46 6431905400 $27.46 Page 175 of 189 City of Chula Vista Engineer's ReportPage 390 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6431910100 $27.46 6431910200 $27.46 6431910300 $27.46 6431910400 $27.46 6431910500 $27.46 6431910600 $27.46 6431910700 $27.46 6431910800 $27.46 6431910900 $27.46 6431911000 $27.46 6431911100 $27.46 6431911200 $27.46 6431911300 $27.46 6431911400 $27.46 6431911500 $27.46 6431911600 $27.46 6431911700 $27.46 6431911800 $27.46 6431911900 $27.46 6431912000 $27.46 6431912100 $27.46 6431912200 $27.46 6432000100 $27.46 6432000200 $27.46 6432000300 $27.46 6432000400 $27.46 6432000500 $27.46 6432000600 $27.46 6432000700 $27.46 6432000800 $27.46 6432000900 $27.46 6432001000 $27.46 6432001100 $27.46 6432001200 $27.46 6432001300 $27.46 6432001400 $27.46 6432001500 $27.46 6432001600 $27.46 6432001700 $27.46 6432001800 $27.46 6432001900 $27.46 6432002000 $27.46 6432002100 $27.46 6432002200 $27.46 6432002300 $27.46 6432002400 $27.46 6432002500 $27.46 6432002600 $27.46 6432002700 $27.46 6432002800 $27.46 6432002900 $27.46 6432003000 $27.46 6432003100 $27.46 6432003200 $27.46 6432003300 $27.46 6432003400 $27.46 6432003500 $27.46 6432003600 $27.46 6432003700 $27.46 6432003800 $27.46 6432003900 $27.46 6432010100 $27.46 6432010200 $27.46 6432010300 $27.46 6432010400 $27.46 6432010500 $27.46 6432010600 $27.46 6432010700 $27.46 6432010800 $27.46 6432010900 $27.46 6432011000 $27.46 6432011100 $27.46 6432011200 $27.46 6432011300 $27.46 6432011400 $27.46 6432011500 $27.46 6432011600 $27.46 6432011700 $27.46 6432011800 $27.46 6432011900 $27.46 6432012000 $27.46 6432012100 $27.46 6432012200 $27.46 6432012300 $27.46 6432012400 $27.46 6432012500 $27.46 6432012600 $27.46 6432012700 $27.46 6432012800 $27.46 6432012900 $27.46 6432013000 $27.46 6432013100 $27.46 6432100100 $32.94 6432100200 $32.94 6432100300 $32.94 6432100400 $32.94 6432100500 $32.94 6432100600 $32.94 6432100700 $32.94 6432100800 $32.94 6432100900 $32.94 6432101000 $32.94 6432101100 $32.94 6432101200 $32.94 6432101300 $32.94 6432101400 $32.94 6432101500 $32.94 6432101600 $32.94 6432101700 $32.94 6432101800 $32.94 6432101900 $32.94 6432102000 $32.94 6432102100 $32.94 6432102200 $32.94 6432102300 $32.94 6432102400 $32.94 6432102500 $32.94 6432103200 $32.94 6432103600 $27.46 6432103700 $27.46 6432103800 $27.46 6432103900 $27.46 6432104000 $27.46 6432104100 $27.46 6432104200 $27.46 6432104300 $27.46 6432104400 $27.46 6432104500 $27.46 6432104600 $27.46 6432104700 $27.46 6432104800 $27.46 6432104900 $27.46 6432105000 $27.46 6432105100 $27.46 6432105200 $27.46 6432105300 $27.46 6432105400 $27.46 6432105500 $32.94 6432105600 $32.94 6432105700 $32.94 6432105800 $32.94 Page 176 of 189 City of Chula Vista Engineer's ReportPage 391 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6432105900 $32.94 6432106000 $32.94 6432106100 $32.94 6432110100 $32.94 6432110200 $32.94 6432110300 $32.94 6432110400 $32.94 6432110500 $32.94 6432110600 $32.94 6432110700 $32.94 6432110800 $32.94 6432110900 $32.94 6432111000 $32.94 6432111700 $32.94 6432111800 $32.94 6432111900 $32.94 6432112200 $27.46 6432112300 $27.46 6432112400 $27.46 6432112500 $27.46 6432112600 $27.46 6432112700 $27.46 6432112800 $27.46 6432112900 $27.46 6432113000 $27.46 6432113100 $27.46 6432113200 $27.46 6432113300 $27.46 6432113400 $27.46 6432113500 $27.46 6432113600 $27.46 6432113900 $27.46 6432114000 $27.46 6432114100 $27.46 6432114200 $27.46 6432114300 $27.46 6432114400 $27.46 6432114500 $27.46 6432114600 $27.46 6432114700 $27.46 6432114800 $27.46 6432114900 $27.46 6432115000 $27.46 6432115100 $32.94 6432115200 $32.94 6432115300 $32.94 6432115400 $32.94 6432115500 $32.94 6432115600 $32.94 6432115900 $27.46 6432116300 $27.46 6432200100 $27.46 6432200200 $27.46 6432200300 $27.46 6432200400 $27.46 6432200500 $27.46 6432200600 $27.46 6432200700 $27.46 6432200800 $27.46 6432200900 $27.46 6432201000 $27.46 6432201100 $27.46 6432201200 $27.46 6432201300 $27.46 6432201400 $27.46 6432201500 $27.46 6432201600 $27.46 6432201700 $27.46 6432201800 $27.46 6432201900 $27.46 6432202000 $27.46 6432202100 $27.46 6432202200 $27.46 6432202300 $27.46 6432202400 $27.46 6432202500 $27.46 6432202600 $27.46 6432202700 $27.46 6432202800 $27.46 6432202900 $27.46 6432203000 $27.46 6432203100 $27.46 6432203200 $27.46 6432210100 $27.46 6432210200 $27.46 6432210300 $27.46 6432210400 $27.46 6432210500 $27.46 6432210600 $27.46 6432210700 $27.46 6432210800 $27.46 6432210900 $27.46 6432211000 $27.46 6432211100 $27.46 6432211200 $27.46 6432211300 $27.46 6432211400 $27.46 6432211500 $27.46 6432211600 $27.46 6432211700 $27.46 6432211800 $27.46 6432211900 $27.46 6432212000 $27.46 6432212100 $27.46 6432212200 $27.46 6432212300 $27.46 6432212400 $27.46 6432212500 $27.46 6432212600 $27.46 6432212700 $27.46 6432212800 $27.46 6432300100 $27.46 6432300200 $27.46 6432300300 $27.46 6432300400 $27.46 6432300500 $27.46 6432300600 $27.46 6432300700 $27.46 6432300800 $27.46 6432300900 $27.46 6432301000 $27.46 6432301100 $27.46 6432301200 $27.46 6432301300 $27.46 6432301400 $27.46 6432301500 $27.46 6432301600 $27.46 6432301700 $27.46 6432301800 $27.46 6432301900 $27.46 6432302000 $27.46 6432302100 $27.46 6432302200 $27.46 6432302300 $27.46 6432302400 $27.46 6432302500 $27.46 6432302600 $27.46 6432302700 $27.46 6432302800 $27.46 6432302900 $27.46 6432303000 $27.46 Page 177 of 189 City of Chula Vista Engineer's ReportPage 392 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6432303100 $27.46 6432303200 $27.46 6432303300 $27.46 6432303400 $27.46 6432303500 $27.46 6432303600 $27.46 6432303700 $27.46 6432303800 $27.46 6432303900 $27.46 6432304000 $27.46 6432304100 $27.46 6432304200 $27.46 6432304300 $27.46 6432304400 $27.46 6432304500 $27.46 6432304600 $27.46 6432304700 $27.46 6432304800 $27.46 6432304900 $27.46 6432305000 $27.46 6432305100 $27.46 6432305200 $27.46 6432305300 $27.46 6432305400 $27.46 6432305500 $27.46 6432305600 $27.46 6432305700 $27.46 6432305800 $27.46 6432305900 $27.46 6432306000 $27.46 6432306100 $27.46 6432310100 $27.46 6432310200 $27.46 6432310300 $27.46 6432310400 $27.46 6432310500 $27.46 6432310600 $27.46 6432310700 $27.46 6432310800 $27.46 6432310900 $27.46 6432311000 $27.46 6432311100 $27.46 6432311200 $27.46 6432311300 $27.46 6432311400 $27.46 6432311500 $27.46 6432311600 $27.46 6432311700 $27.46 6432311800 $27.46 6432311900 $27.46 6432312000 $27.46 6432312100 $27.46 6432312200 $27.46 6432312300 $27.46 6432312400 $27.46 6432312500 $27.46 6432312600 $27.46 6432312700 $27.46 6432312800 $27.46 6432312900 $27.46 6432313000 $27.46 6432313100 $27.46 6432313200 $27.46 6432313300 $27.46 6432313400 $27.46 6432313500 $27.46 6432313600 $27.46 6432313700 $27.46 6432313800 $27.46 6432313900 $27.46 6432314000 $27.46 6432314100 $27.46 6432314200 $27.46 6432314300 $27.46 6432314400 $27.46 6432314500 $27.46 6432314600 $27.46 6432314700 $27.46 6432314800 $27.46 6432314900 $27.46 6432315000 $27.46 6432315100 $27.46 6432315200 $27.46 6432315300 $27.46 6432315400 $27.46 6432315500 $27.46 6432315600 $27.46 6432315700 $27.46 6432315800 $27.46 6432315900 $27.46 6432316000 $27.46 6432316100 $27.46 6432316300 $27.46 6432316400 $27.46 6432316500 $27.46 6432316600 $27.46 6432316700 $27.46 6432316800 $27.46 6432316900 $27.46 6432317000 $27.46 6432317100 $27.46 6432320100 $27.46 6432320200 $27.46 6432320300 $27.46 6432320400 $27.46 6432320500 $27.46 6432320600 $27.46 6432320700 $27.46 6432320800 $27.46 6432320900 $27.46 6432321000 $27.46 6432321100 $27.46 6432321200 $27.46 6432321300 $27.46 6432321400 $27.46 6432321500 $27.46 6432321600 $27.46 6432321700 $27.46 6432321800 $27.46 6432321900 $27.46 6432322000 $27.46 6432322100 $27.46 6432322200 $27.46 6432322300 $27.46 6432322400 $27.46 6432322500 $27.46 6432322600 $27.46 6432322700 $27.46 6432322800 $27.46 6432322900 $27.46 6432323000 $27.46 6432323100 $27.46 6432323200 $27.46 6432323300 $27.46 6432323400 $27.46 6432323500 $27.46 6432323600 $27.46 6432323700 $27.46 6432323800 $27.46 6432323900 $27.46 6432324000 $27.46 Page 178 of 189 City of Chula Vista Engineer's ReportPage 393 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-89 - ELMD Zone B Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6432324100 $27.46 6432324200 $27.46 6432324300 $27.46 6432324400 $27.46 6432324500 $27.46 6432324600 $27.46 6432324700 $27.46 6432324800 $27.46 6432324900 $27.46 6432325000 $27.46 6432330100 $27.46 6432330200 $27.46 6432330300 $27.46 6432330400 $27.46 6432330500 $27.46 6432330600 $27.46 6432330700 $27.46 6432330800 $27.46 6432330900 $27.46 6432331000 $27.46 6432331100 $27.46 6432331200 $27.46 6432331300 $27.46 6432331400 $27.46 6432331500 $27.46 6432331600 $27.46 6432331700 $27.46 6432331800 $27.46 6432331900 $27.46 6432332000 $27.46 6432332100 $27.46 6432332200 $27.46 6432332300 $27.46 6432332400 $27.46 6432332500 $27.46 6432332600 $27.46 6432332700 $27.46 6432332800 $27.46 6432332900 $27.46 6432333000 $27.46 6432333100 $27.46 6432333200 $27.46 6432333300 $27.46 6432333400 $27.46 6432333500 $27.46 6432333600 $27.46 6432333700 $27.46 6432333800 $27.46 6432333900 $27.46 6432334000 $27.46 6432334100 $27.46 6432334200 $27.46 6432334300 $27.46 6432334400 $27.46 6432334500 $27.46 6432334600 $27.46 6432334700 $27.46 6432334800 $27.46 6432334900 $27.46 6432500100 $27.46 6432500200 $27.46 6432500300 $27.46 6432500400 $27.46 6432500500 $27.46 6432500600 $27.46 6432500700 $27.46 6432500800 $27.46 6432500900 $27.46 6432501000 $27.46 6432501100 $27.46 6432501200 $27.46 6432501300 $27.46 6432501400 $27.46 6432501500 $27.46 6432501600 $27.46 6432501700 $27.46 6432501800 $27.46 6432501900 $27.46 6432502000 $27.46 6432502100 $27.46 6432502200 $27.46 6432502300 $27.46 6432502400 $27.46 6432502500 $27.46 6432502600 $27.46 6432502700 $27.46 6432502800 $27.46 6432502900 $27.46 6432503000 $27.46 6432503100 $27.46 6432510100 $27.46 6432510200 $27.46 6432510300 $27.46 6432510400 $27.46 6432510500 $27.46 6432510600 $27.46 6432510700 $27.46 6432510800 $27.46 6432510900 $27.46 6432511000 $27.46 6432511100 $27.46 6432511200 $27.46 6432511300 $27.46 6432511400 $27.46 6432511500 $27.46 6432511600 $27.46 6432511700 $27.46 6432511800 $27.46 6432511900 $27.46 6432512000 $27.46 6432512100 $27.46 Totals Parcels 2,367 Levy $92,681.80 Page 179 of 189 City of Chula Vista Engineer's ReportPage 394 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-90 - ELMD Zone C Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6430402500 $4,110.04 6430402600 $18,497.06 6430402700 $27,038.88 6430402800 $4,579.98 Totals Parcels 4 Levy $54,225.96 Assessment Roll Page 180 of 189 City of Chula Vista Engineer's ReportPage 395 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-91 - ELMD Zone D Fiscal Year 2023-24 APN Levy APN Levy APN Levy 5953800100 $303.30 5953800200 $303.30 5953800300 $303.30 5953800400 $303.30 5953800500 $303.30 5953800600 $303.30 5953800700 $303.30 5953800800 $303.30 5953800900 $303.30 5953801000 $303.30 5953801100 $303.30 5953801200 $303.30 5953801300 $303.30 5953801400 $303.30 5953801500 $303.30 5953801600 $303.30 5953801700 $303.30 5953801800 $303.30 5953801900 $303.30 5953802000 $303.30 5953802100 $303.30 5953802200 $303.30 5953802300 $303.30 5953802400 $303.30 5953802500 $303.30 5953802600 $303.30 5953802700 $303.30 5953802800 $303.30 5953802900 $303.30 5953803000 $303.30 5953803100 $303.30 5953803200 $303.30 5953803300 $303.30 5953803400 $303.30 5953803500 $303.30 5953803600 $303.30 5953803700 $303.30 5953803800 $303.30 5953803900 $303.30 5953804000 $303.30 5953804100 $303.30 5953804200 $303.30 5953804300 $303.30 5953804400 $303.30 5953804500 $303.30 5953804600 $303.30 5953804700 $303.30 5953804800 $303.30 5953804900 $303.30 5953805000 $303.30 5953805100 $303.30 5953810100 $303.30 5953810200 $303.30 5953810300 $303.30 5953810400 $303.30 5953810500 $303.30 5953810600 $303.30 5953810700 $303.30 5953810800 $303.30 5953810900 $303.30 5953811000 $303.30 5953811100 $303.30 5953811200 $303.30 5953811300 $303.30 5953811400 $303.30 5953811500 $303.30 5953811600 $303.30 5953811700 $303.30 5953811800 $303.30 5953811900 $303.30 5953900100 $303.30 5953900200 $303.30 5953900300 $303.30 5953900400 $303.30 5953900500 $303.30 5953900600 $303.30 5953900700 $303.30 5953900800 $303.30 5953900900 $303.30 5953901000 $303.30 5953901100 $303.30 5953901200 $303.30 5953901300 $303.30 5953901400 $303.30 5953901500 $303.30 5953901600 $303.30 5953901700 $303.30 5953901800 $303.30 5953901900 $303.30 5953902000 $303.30 5953902100 $303.30 5953902200 $303.30 5953902300 $303.30 5953902400 $303.30 5953902500 $303.30 5953902600 $303.30 5953902700 $303.30 5953902800 $303.30 5953902900 $303.30 5953903000 $303.30 5953903100 $303.30 5953903200 $303.30 5953903300 $303.30 5953903400 $303.30 5953903500 $303.30 5953903600 $303.30 5953903700 $303.30 5953903800 $303.30 5954000100 $303.30 5954000200 $303.30 5954000300 $303.30 5954000400 $303.30 5954000500 $303.30 5954000600 $303.30 5954000700 $303.30 5954000800 $303.30 5954000900 $303.30 5954001000 $303.30 5954001100 $303.30 5954001200 $303.30 5954001300 $303.30 5954001400 $303.30 5954001500 $303.30 5954001600 $303.30 5954001700 $303.30 5954001800 $303.30 5954001900 $303.30 5954002000 $303.30 5954002100 $303.30 5954002200 $303.30 5954002300 $303.30 5954002400 $303.30 5954002500 $303.30 5954002600 $303.30 5954002700 $303.30 5954002800 $303.30 5954002900 $303.30 5954003000 $303.30 5954003100 $303.30 5954003200 $303.30 5954003300 $303.30 Assessment Roll Page 181 of 189 City of Chula Vista Engineer's ReportPage 396 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-91 - ELMD Zone D Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954003400 $303.30 5954003500 $303.30 5954003600 $303.30 5954003700 $303.30 5954003800 $303.30 5954003900 $303.30 5954004000 $303.30 5954004100 $303.30 5954004200 $303.30 5954004300 $303.30 5954004400 $303.30 5954004500 $303.30 5954004600 $303.30 5954004700 $303.30 5954004800 $303.30 5954004900 $303.30 5954005000 $303.30 5954005100 $303.30 5954005200 $303.30 5954005300 $303.30 5954005400 $303.30 5954005500 $303.30 5954005600 $303.30 5954005700 $303.30 5954005800 $303.30 5954100201 $242.64 5954100202 $242.64 5954100203 $242.64 5954100204 $242.64 5954100205 $242.64 5954100206 $242.64 5954100207 $242.64 5954100208 $242.64 5954100209 $242.64 5954100210 $242.64 5954100211 $242.64 5954100212 $242.64 5954100213 $242.64 5954100214 $242.64 5954100215 $242.64 5954100216 $242.64 5954100217 $242.64 5954100218 $242.64 5954100219 $242.64 5954100220 $242.64 5954100221 $242.64 5954100222 $242.64 5954100223 $242.64 5954100224 $242.64 5954100225 $242.64 5954100301 $242.64 5954100302 $242.64 5954100303 $242.64 5954100304 $242.64 5954100305 $242.64 5954100306 $242.64 5954100307 $242.64 5954100308 $242.64 5954100309 $242.64 5954100310 $242.64 5954100311 $242.64 5954100312 $242.64 5954100313 $242.64 5954100314 $242.64 5954100315 $242.64 5954100316 $242.64 5954100317 $242.64 5954100318 $242.64 5954100319 $242.64 5954100320 $242.64 5954100321 $242.64 5954100322 $242.64 5954100401 $242.64 5954100402 $242.64 5954100403 $242.64 5954100404 $242.64 5954100405 $242.64 5954100406 $242.64 5954100407 $242.64 5954100408 $242.64 5954100409 $242.64 5954100410 $242.64 5954100411 $242.64 5954100412 $242.64 5954100413 $242.64 5954100414 $242.64 5954100415 $242.64 5954100416 $242.64 5954100417 $242.64 5954100418 $242.64 5954100501 $242.64 5954100502 $242.64 5954100503 $242.64 5954100504 $242.64 5954100505 $242.64 5954100506 $242.64 5954100507 $242.64 5954100508 $242.64 5954100509 $242.64 5954100510 $242.64 5954100511 $242.64 5954100512 $242.64 5954100513 $242.64 5954100514 $242.64 5954100515 $242.64 5954100516 $242.64 5954101101 $242.64 5954101102 $242.64 5954101103 $242.64 5954101104 $242.64 5954101105 $242.64 5954101106 $242.64 5954101107 $242.64 5954101108 $242.64 5954101109 $242.64 5954101110 $242.64 5954101111 $242.64 5954101112 $242.64 5954101113 $242.64 5954101114 $242.64 5954101115 $242.64 5954102001 $242.64 5954102002 $242.64 5954102003 $242.64 5954102004 $242.64 5954102005 $242.64 5954102006 $242.64 5954102007 $242.64 5954102008 $242.64 5954102009 $242.64 5954102010 $242.64 5954102011 $242.64 5954102012 $242.64 5954102013 $242.64 5954102014 $242.64 5954102015 $242.64 5954102016 $242.64 5954102017 $242.64 5954102301 $242.64 5954102302 $242.64 5954102303 $242.64 Page 182 of 189 City of Chula Vista Engineer's ReportPage 397 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-91 - ELMD Zone D Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954102304 $242.64 5954102305 $242.64 5954102306 $242.64 5954102307 $242.64 5954102308 $242.64 5954102309 $242.64 5954102310 $242.64 5954102311 $242.64 5954102312 $242.64 5954102313 $242.64 5954102314 $242.64 5954102315 $242.64 5954102316 $242.64 5954102401 $242.64 5954102402 $242.64 5954102403 $242.64 5954102404 $242.64 5954102405 $242.64 5954102406 $242.64 5954102407 $242.64 5954102408 $242.64 5954102409 $242.64 5954102410 $242.64 5954102411 $242.64 5954102412 $242.64 5954102413 $242.64 5954102414 $242.64 5954102415 $242.64 5954102416 $242.64 5954102417 $242.64 5954102418 $242.64 5954102419 $242.64 5954102601 $242.64 5954102602 $242.64 5954102603 $242.64 5954102604 $242.64 5954102605 $242.64 5954102606 $242.64 5954102607 $242.64 5954102608 $242.64 5954102609 $242.64 5954102610 $242.64 5954102611 $242.64 5954102612 $242.64 5954102613 $242.64 5954102614 $242.64 5954102615 $242.64 5954102616 $242.64 5954102617 $242.64 5954102618 $242.64 5954102619 $242.64 5954102620 $242.64 5954102621 $242.64 5954102622 $242.64 5954102623 $242.64 5954102624 $242.64 5954102625 $242.64 5954102626 $242.64 5954102627 $242.64 5954102628 $242.64 5954102629 $242.64 5954102630 $242.64 5954102631 $242.64 5954102632 $242.64 5954102633 $242.64 5954102634 $242.64 5954102635 $242.64 5954102636 $242.64 5954102637 $242.64 5954102638 $242.64 5954102639 $242.64 5954102801 $242.64 5954102802 $242.64 5954102803 $242.64 5954102804 $242.64 5954102805 $242.64 5954102806 $242.64 5954102807 $242.64 5954102808 $242.64 5954102809 $242.64 5954102810 $242.64 5954102811 $242.64 5954102812 $242.64 5954102813 $242.64 5954102814 $242.64 5954102815 $242.64 5954102816 $242.64 5954102817 $242.64 5954102818 $242.64 5954102819 $242.64 5954102820 $242.64 5954102821 $242.64 5954102822 $242.64 5954102823 $242.64 5954102824 $242.64 5954102825 $242.64 5954102826 $242.64 5954102827 $242.64 5954102828 $242.64 5954102829 $242.64 5954200201 $181.98 5954200202 $181.98 5954200203 $181.98 5954200204 $181.98 5954200205 $181.98 5954200206 $181.98 5954200301 $181.98 5954200302 $181.98 5954200303 $181.98 5954200304 $181.98 5954200305 $181.98 5954200306 $181.98 5954200307 $181.98 5954200308 $181.98 5954200309 $181.98 5954200310 $181.98 5954200311 $181.98 5954200312 $181.98 5954200313 $181.98 5954200314 $181.98 5954200315 $181.98 5954200316 $181.98 5954200317 $181.98 5954200318 $181.98 5954200401 $181.98 5954200402 $181.98 5954200403 $181.98 5954200404 $181.98 5954200405 $181.98 5954200406 $181.98 5954200407 $181.98 5954200408 $181.98 5954200409 $181.98 5954200410 $181.98 5954200411 $181.98 5954200412 $181.98 5954200413 $181.98 5954200414 $181.98 5954200415 $181.98 5954200501 $181.98 5954200502 $181.98 Page 183 of 189 City of Chula Vista Engineer's ReportPage 398 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-91 - ELMD Zone D Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 5954200503 $181.98 5954200504 $181.98 5954200505 $181.98 5954200506 $181.98 5954200507 $181.98 5954200508 $181.98 5954200509 $181.98 5954200510 $181.98 5954200511 $181.98 5954200512 $181.98 5954200513 $181.98 5954200514 $181.98 5954200515 $181.98 5954200601 $181.98 5954200602 $181.98 5954200603 $181.98 5954200604 $181.98 5954200605 $181.98 5954200606 $181.98 5954200607 $181.98 5954200608 $181.98 5954200609 $181.98 5954200610 $181.98 5954200611 $181.98 5954200612 $181.98 5954200701 $181.98 5954200702 $181.98 5954200703 $181.98 5954200704 $181.98 5954200705 $181.98 5954200706 $181.98 5954200707 $181.98 5954200708 $181.98 5954200709 $181.98 5954200710 $181.98 5954200711 $181.98 5954200712 $181.98 5954200713 $181.98 5954200714 $181.98 5954200715 $181.98 5954200716 $181.98 5954200717 $181.98 5954200718 $181.98 5954200801 $181.98 5954200802 $181.98 5954200803 $181.98 5954200804 $181.98 5954200805 $181.98 5954200806 $181.98 5954200807 $181.98 5954200808 $181.98 5954200809 $181.98 5954200810 $181.98 5954200811 $181.98 5954200812 $181.98 5954200813 $181.98 5954200814 $181.98 5954200815 $181.98 5954200901 $181.98 5954200902 $181.98 5954200903 $181.98 5954200904 $181.98 5954200905 $181.98 5954200906 $181.98 5954200907 $181.98 5954200908 $181.98 5954200909 $181.98 5954200910 $181.98 5954200911 $181.98 5954200912 $181.98 5954200913 $181.98 5954200914 $181.98 5954200915 $181.98 5954200916 $181.98 5954200917 $181.98 5954200918 $181.98 5954200919 $181.98 5954200920 $181.98 5954200921 $181.98 5954200922 $181.98 5954200923 $181.98 5954200924 $181.98 5954200925 $181.98 5954200926 $181.98 5954200927 $181.98 5954200928 $181.98 5954200929 $181.98 5954200930 $181.98 5954201001 $181.98 5954201002 $181.98 5954201003 $181.98 5954201004 $181.98 5954201005 $181.98 5954201006 $181.98 5954201007 $181.98 5954201008 $181.98 5954201009 $181.98 5954201010 $181.98 5954201011 $303.30 5954201012 $181.98 Totals Parcels 523 Levy $128,538.54 Page 184 of 189 City of Chula Vista Engineer's ReportPage 399 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-92 - ELMD Zone E Fiscal Year 2023-24 APN Levy APN Levy APN Levy 6400501800 $225.40 6400501900 $95.20 6400804700 $20.00 6401910100 $20.00 6401910200 $20.00 6401910300 $20.00 6401910400 $20.00 6401910500 $20.00 6401910600 $20.00 6401910700 $20.00 6401910800 $20.00 6401910900 $20.00 6401911000 $20.00 6401911100 $20.00 6401911200 $20.00 6401911300 $20.00 6401911400 $20.00 6401911500 $20.00 6401911600 $20.00 6401911700 $20.00 6401911800 $20.00 6401911900 $20.00 6401912000 $20.00 6401920100 $20.00 6401920200 $20.00 6401920300 $20.00 6401920400 $20.00 6401920500 $20.00 6401920600 $20.00 6401920700 $20.00 6401920800 $20.00 6401920900 $20.00 6401921000 $20.00 6401921100 $20.00 6401921200 $20.00 6401921300 $20.00 6401921400 $20.00 6401921500 $20.00 6401921600 $20.00 6401921700 $20.00 6401921800 $20.00 6401921900 $20.00 6401922000 $20.00 6401922100 $20.00 6401922200 $20.00 6401922300 $20.00 6401922400 $20.00 6401922500 $20.00 6401922600 $20.00 6401922700 $20.00 6401922800 $20.00 6401922900 $20.00 6401923000 $20.00 6401923100 $20.00 6401923200 $20.00 6401923300 $20.00 6401923400 $20.00 6401930100 $20.00 6401930200 $20.00 6401930300 $20.00 6401930400 $20.00 6401930500 $20.00 6401930600 $20.00 6401930700 $20.00 6401930800 $20.00 6401930900 $20.00 6401931000 $20.00 6401931100 $20.00 6401931200 $20.00 6401931300 $20.00 6401931400 $20.00 6401931500 $20.00 6401931600 $20.00 6401931700 $20.00 6401931800 $20.00 6401931900 $20.00 6401932000 $20.00 6401932100 $20.00 6401932200 $20.00 6401932300 $20.00 6401932400 $20.00 6401932500 $20.00 6401932600 $20.00 6401932700 $20.00 6401932800 $20.00 6401932900 $20.00 6401933000 $20.00 6401933100 $20.00 6401933200 $20.00 6401933300 $20.00 6401933800 $20.00 6401940100 $20.00 6401940200 $20.00 6401940300 $20.00 6401940400 $20.00 6401940500 $20.00 6401940600 $20.00 6401940700 $20.00 6401940800 $20.00 6401940900 $20.00 6401941000 $20.00 6401941100 $20.00 6401941200 $20.00 6401941300 $20.00 6401941400 $20.00 6401941500 $20.00 6401941600 $20.00 6401941700 $20.00 6401941800 $20.00 6401941900 $20.00 6401942000 $20.00 6401942100 $20.00 6401942200 $20.00 6401942300 $20.00 6401942400 $20.00 6401942500 $20.00 6401942600 $20.00 6401942700 $20.00 6401942800 $20.00 6401942900 $20.00 6401943000 $20.00 6401950100 $20.00 6401950200 $20.00 6401950300 $20.00 6401950400 $20.00 6401950500 $20.00 6401950600 $20.00 6401950700 $20.00 6401950800 $20.00 6401950900 $20.00 6401951000 $20.00 6401951100 $20.00 6401951200 $20.00 6401951300 $20.00 6401951400 $20.00 6401951500 $20.00 6401951600 $20.00 6401951700 $20.00 6401951800 $20.00 6401951900 $20.00 6401960100 $20.00 Assessment Roll Page 185 of 189 City of Chula Vista Engineer's ReportPage 400 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-92 - ELMD Zone E Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6401960200 $20.00 6401960300 $20.00 6401960400 $20.00 6401960500 $20.00 6401960600 $20.00 6401960700 $20.00 6401960800 $20.00 6401960900 $20.00 6401961000 $20.00 6401961100 $20.00 6401961200 $20.00 6401961300 $20.00 6401961400 $20.00 6401961500 $20.00 6401961600 $20.00 6401961700 $20.00 6401961800 $20.00 6401961900 $20.00 6401962000 $20.00 6401962100 $20.00 6401962200 $20.00 6401962300 $20.00 6401970100 $20.00 6401970200 $20.00 6401970300 $20.00 6401970400 $20.00 6401970500 $20.00 6401970600 $20.00 6401970700 $20.00 6401970800 $20.00 6401970900 $20.00 6401971000 $20.00 6401971100 $20.00 6401971200 $20.00 6401971300 $20.00 6401971400 $20.00 6401971500 $20.00 6401971600 $20.00 6401971700 $20.00 6401971800 $20.00 6401971900 $20.00 6401972000 $20.00 6401972100 $20.00 6401972200 $20.00 6401972300 $20.00 6401972400 $20.00 6401972500 $20.00 6401972600 $20.00 6401972700 $20.00 6401972800 $20.00 6401972900 $20.00 6401973000 $20.00 6401973100 $20.00 6401973200 $20.00 6401973300 $20.00 6401973400 $20.00 6401980100 $20.00 6401980200 $20.00 6401980300 $20.00 6401980400 $20.00 6401980500 $20.00 6401980600 $20.00 6401980700 $20.00 6401980800 $20.00 6401980900 $20.00 6401981000 $20.00 6401981100 $20.00 6401981200 $20.00 6401981300 $20.00 6401981400 $20.00 6401981500 $20.00 6401981600 $20.00 6401981700 $20.00 6401981800 $20.00 6401981900 $20.00 6401982000 $20.00 6401982100 $20.00 6401982200 $20.00 6401982300 $20.00 6401982400 $20.00 6401982500 $20.00 6401982600 $20.00 6402000100 $20.00 6402000200 $20.00 6402000300 $20.00 6402000400 $20.00 6402000500 $20.00 6402000600 $20.00 6402000700 $20.00 6402000800 $20.00 6402000900 $20.00 6402001000 $20.00 6402001100 $20.00 6402001200 $20.00 6402001300 $20.00 6402001400 $20.00 6402001500 $20.00 6402001600 $20.00 6402001700 $20.00 6402001800 $20.00 6402001900 $20.00 6402002000 $20.00 6402002100 $20.00 6402002200 $20.00 6402002300 $20.00 6402002400 $20.00 6402002500 $20.00 6402002600 $20.00 6402002700 $20.00 6402002800 $20.00 6402002900 $20.00 6402003000 $20.00 6402003100 $20.00 6402003200 $20.00 6402003300 $20.00 6402003400 $20.00 6402003500 $20.00 6402003600 $20.00 6402003700 $20.00 6402003800 $20.00 6402003900 $20.00 6402004000 $20.00 6402004100 $20.00 6402004200 $20.00 6402004300 $20.00 6402004400 $20.00 6402004500 $20.00 6402004600 $20.00 6402004700 $20.00 6402004800 $20.00 6402004900 $20.00 6402005000 $20.00 6402005100 $20.00 6402005200 $20.00 6402005300 $20.00 6402005400 $20.00 6402005500 $20.00 6402005600 $20.00 6402005700 $20.00 6402005800 $20.00 6402005900 $20.00 Page 186 of 189 City of Chula Vista Engineer's ReportPage 401 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-92 - ELMD Zone E Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402006000 $20.00 6402006100 $20.00 6402006200 $20.00 6402006300 $20.00 6402006400 $20.00 6402006500 $20.00 6402006600 $20.00 6402006700 $20.00 6402006800 $20.00 6402006900 $20.00 6402007000 $20.00 6402007100 $20.00 6402007200 $20.00 6402007300 $20.00 6402007400 $20.00 6402007500 $20.00 6402007600 $20.00 6402110300 $20.00 6402110400 $20.00 6402110500 $20.00 6402110600 $20.00 6402110700 $20.00 6402110800 $20.00 6402110900 $20.00 6402111000 $20.00 6402111100 $20.00 6402111200 $20.00 6402111300 $20.00 6402112500 $20.00 6402112600 $20.00 6402120100 $20.00 6402120200 $20.00 6402120300 $20.00 6402120400 $20.00 6402120500 $20.00 6402120600 $20.00 6402120700 $20.00 6402120800 $20.00 6402120900 $20.00 6402121000 $20.00 6402121100 $20.00 6402121200 $20.00 6402121300 $20.00 6402121400 $20.00 6402130100 $20.00 6402130200 $20.00 6402130300 $20.00 6402130400 $20.00 6402130500 $20.00 6402130600 $20.00 6402130700 $20.00 6402130800 $20.00 6402130900 $20.00 6402131000 $20.00 6402131100 $20.00 6402131200 $20.00 6402131300 $20.00 6402131400 $20.00 6402131500 $20.00 6402131600 $20.00 6402131700 $20.00 6402131800 $20.00 6402131900 $20.00 6402132000 $20.00 6402132100 $20.00 6402210100 $20.00 6402210200 $20.00 6402210300 $20.00 6402210400 $20.00 6402210500 $20.00 6402210600 $20.00 6402210700 $20.00 6402210800 $20.00 6402210900 $20.00 6402211000 $20.00 6402211100 $20.00 6402211200 $20.00 6402211300 $20.00 6402211400 $20.00 6402211500 $20.00 6402211600 $20.00 6402211700 $20.00 6402211800 $20.00 6402211900 $20.00 6402212000 $20.00 6402212100 $20.00 6402212200 $20.00 6402212300 $20.00 6402212400 $20.00 6402212500 $20.00 6402220100 $20.00 6402220200 $20.00 6402220300 $20.00 6402220400 $20.00 6402220500 $20.00 6402220600 $20.00 6402220700 $20.00 6402220800 $20.00 6402220900 $20.00 6402221000 $20.00 6402221100 $20.00 6402221200 $20.00 6402221300 $20.00 6402221400 $20.00 6402221500 $20.00 6402221600 $20.00 6402221700 $20.00 6402221800 $20.00 6402221900 $20.00 6402222000 $20.00 6402222100 $20.00 6402222200 $20.00 6402222300 $20.00 6402222400 $20.00 6402222500 $20.00 6402222600 $20.00 6402222700 $20.00 6402222800 $20.00 6402222900 $20.00 6402223000 $20.00 6402223100 $20.00 6402223200 $20.00 6402223300 $20.00 6402223400 $20.00 6402223500 $20.00 6402310100 $20.00 6402310200 $20.00 6402310300 $20.00 6402310400 $20.00 6402310500 $20.00 6402310600 $20.00 6402310700 $20.00 6402310800 $20.00 6402310900 $20.00 6402311000 $20.00 6402311100 $20.00 6402311200 $20.00 6402311300 $20.00 6402311400 $20.00 6402311500 $20.00 6402311600 $20.00 Page 187 of 189 City of Chula Vista Engineer's ReportPage 402 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-92 - ELMD Zone E Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402311700 $20.00 6402311800 $20.00 6402311900 $20.00 6402312000 $20.00 6402312100 $20.00 6402312200 $20.00 6402312300 $20.00 6402312400 $20.00 6402312500 $20.00 6402312600 $20.00 6402312700 $20.00 6402312800 $20.00 6402312900 $20.00 6402313000 $20.00 6402313100 $20.00 6402313200 $20.00 6402313300 $20.00 6402313400 $20.00 6402313500 $20.00 6402313600 $20.00 6402313700 $20.00 6402313800 $20.00 6402313900 $20.00 6402314000 $20.00 6402314100 $20.00 6402314200 $20.00 6402314300 $20.00 6402314400 $20.00 6402314500 $20.00 6402314600 $20.00 6402314700 $20.00 6402314800 $20.00 6402314900 $20.00 6402315000 $20.00 6402315100 $20.00 6402315200 $20.00 6402315300 $20.00 6402315400 $20.00 6402315500 $20.00 6402315600 $20.00 6402315700 $20.00 6402315800 $20.00 6402315900 $20.00 6402316000 $20.00 6402316100 $20.00 6402316200 $20.00 6402316300 $20.00 6402316400 $20.00 6402316500 $20.00 6402316600 $20.00 6402316700 $20.00 6402320100 $20.00 6402320200 $20.00 6402320300 $20.00 6402320400 $20.00 6402320500 $20.00 6402320600 $20.00 6402321000 $20.00 6402321100 $20.00 6402321200 $20.00 6402321300 $20.00 6402321400 $20.00 6402321500 $20.00 6402321600 $20.00 6402321700 $20.00 6402321800 $20.00 6402321900 $20.00 6402322000 $20.00 6402322100 $20.00 6402322200 $20.00 6402322300 $20.00 6402322400 $20.00 6402322500 $20.00 6402322600 $20.00 6402322700 $20.00 6402322800 $20.00 6402323100 $20.00 6402323200 $20.00 6402323300 $20.00 6402323400 $20.00 6402323500 $20.00 6402323600 $20.00 6402323700 $20.00 6402323800 $20.00 6402323900 $20.00 6402324000 $20.00 6402324100 $20.00 6402324200 $20.00 6402324300 $20.00 6402324400 $20.00 6402324500 $20.00 6402324600 $20.00 6402324700 $20.00 6402324800 $20.00 6402324900 $20.00 6402325000 $20.00 6402325300 $20.00 6402325600 $20.00 6402325700 $20.00 6402330100 $20.00 6402330200 $20.00 6402330300 $20.00 6402330400 $20.00 6402330500 $20.00 6402330600 $20.00 6402330700 $20.00 6402330800 $20.00 6402330900 $20.00 6402331000 $20.00 6402331100 $20.00 6402331200 $20.00 6402331300 $20.00 6402331400 $20.00 6402331500 $20.00 6402331600 $20.00 6402331700 $20.00 6402331800 $20.00 6402331900 $20.00 6402332000 $20.00 6402332100 $20.00 6402332200 $20.00 6402332300 $20.00 6402332400 $20.00 6402332500 $20.00 6402332600 $20.00 6402332700 $20.00 6402332800 $20.00 6402332900 $20.00 6402333000 $20.00 6402333100 $20.00 6402333200 $20.00 6402333300 $20.00 6402333400 $20.00 6402333500 $20.00 6402333600 $20.00 6402333700 $20.00 6402333800 $20.00 6402333900 $20.00 6402334000 $20.00 6402334100 $20.00 6402334200 $20.00 Page 188 of 189 City of Chula Vista Engineer's ReportPage 403 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6014-92 - ELMD Zone E Fiscal Year 2023-24 APN Levy APN Levy APN Levy Assessment Roll 6402334300 $20.00 6402334400 $20.00 6402334500 $20.00 6402334600 $20.00 6402340100 $20.00 6402340200 $20.00 6402340300 $20.00 6402340400 $20.00 6402340500 $20.00 6402340600 $20.00 6402340700 $20.00 6402340800 $20.00 6402340900 $20.00 6402341000 $20.00 6402341100 $20.00 6402341200 $20.00 6402341300 $20.00 6402341400 $20.00 6402341500 $20.00 6402341600 $20.00 6402341700 $20.00 6402341800 $20.00 6402341900 $20.00 6402342000 $20.00 6402342100 $20.00 6402342200 $20.00 6402342300 $20.00 6402342400 $20.00 6402342500 $20.00 6402342600 $20.00 6402342700 $20.00 6402342800 $20.00 6402342900 $20.00 6402343000 $20.00 6402343100 $20.00 6402343200 $20.00 6402343300 $20.00 6402343400 $20.00 6402343500 $20.00 6402343600 $20.00 6402343700 $20.00 6402343800 $20.00 6402343900 $20.00 6402344000 $20.00 6402344100 $20.00 6402344200 $20.00 6402344300 $20.00 6402344400 $20.00 6402344500 $20.00 6402344600 $20.00 6402344800 $20.00 6402345200 $20.00 6402345300 $20.00 6402345400 $20.00 6402345500 $20.00 6402345600 $20.00 6402345700 $20.00 6402345800 $20.00 6402345900 $20.00 6402346000 $20.00 6402346100 $20.00 6403000100 $20.00 6403000200 $20.00 6403000300 $20.00 6403000400 $20.00 6403000500 $20.00 6403000600 $20.00 6403000700 $20.00 6403000800 $20.00 6403000900 $20.00 6403001000 $20.00 6403001100 $20.00 6403001200 $20.00 6403001300 $20.00 6403001400 $20.00 6403001500 $20.00 6403001600 $20.00 6403001700 $20.00 6403001800 $20.00 6403001900 $20.00 6403002000 $20.00 6403002100 $20.00 6403002200 $20.00 6403002300 $20.00 6403002400 $20.00 6403002500 $20.00 6403002600 $20.00 6403002700 $20.00 6403002800 $20.00 6403002900 $20.00 Totals Parcels 654 Levy $13,360.60 Page 189 of 189 City of Chula Vista Engineer's ReportPage 404 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 405 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda v.003 Page | 1 May 16, 2023 ITEM TITLE Agreement: Approve a Sixth Amendment to the Agreement with the Accounting Firm of Lance Soll and Lunghard, LLP to Provide Audit Services Report Number: 23-0105 Location: No specific geographic location Department: Finance Environmental Notice: The activity is not a "Project" as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. Recommended Action Adopt a resolution approving an amendment to the agreement between City and the accounting firm Lance Soll and Lunghard, LLP for audit services for Fiscal Year 2022-23. SUMMARY Finance Department is requesting the approval of the sixth amendment to the agreement with Lance Soll and Lungard, LLP (LSL) to provide audit services for an additional year, Fiscal Year (FY) 2022-23, for an amount not to exceed $149,951. Section 1017 of the Chula Vista Charter requires an annual independent audit of the City. In 2014, the City approved the agreement with LSL to provide audit services for FY 2013-14 to FY 2017- 18. Since then, due to timing and management staff turnovers in the Finance Department, the City has approved five amendments to the agreement for audit services through FY 2021-22. The Finance Department desires to transition preparation of the Annual Comprehensive Financial Report (ACFR) from the contract auditor to Finance staff, starting with the FY 2022-23 ACFR. To ensure the ACFR preparation is transitioned efficiently and properly, a change to the accounting firm is not advisable at this time. ENVIRONMENTAL REVIEW The Director of Development Services has reviewed the proposed activity for compliance with the California Environmental Quality Act (CEQA) and has determined that the activity is not a “Project” as defined under Page 406 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 2 Section 15378 of the State CEQA Guidelines because the proposed activity consists of a governmental fiscal/administrative activity which does not result in a physical change in the environment; therefore, pursuant to Section 15060(c)(3) of the State CEQA Guidelines, the activity is not subject to CEQA. Thus, no environmental review is required BOARD/COMMISSION/COMMITTEE RECOMMENDATION Not applicable DISCUSSION Section 1017 of the Chula Vista Charter requires an annual independent audit of the City. In 2014 the Finance Department posted a Request for Proposal (RFP) to provide audit services to the City for FY 2013-14 through FY 2017-18. Based on that solicitation, the City approved the agreement with LSL. A brief vacancy and onboarding of a new Finance Manager during the FY 2018-19 audit resulted in reprioritizing of projects. Once the FY 2018-19 audit was completed, staff was required to begin and complete the FY 2019-20 audit. This timing did not allow for the Finance Department to conduct a solicitation; therefore, the City approved fifth amendment to the agreement with LSL to provide audit services for FYs 2020-21 and 2021-22. In FY 2021-22, a new Director of Finance, a new Assistant Director of Finance, and a new Finance Manager were hired. Traditionally included in the audit services agreement, the Finance Department requested the accounting firm at the time to prepare the ACFR. The new Finance management team desires to prepare the ACFR internally by Finance staff, starting with FY 2022-23 ACFR. To ensure the ACFR preparation is transitioned efficiently and properly, a change to the accounting firm is not advisable at this time; therefore, the Finance Department is requesting the approval of the sixth amendment to the agreement with LSL to provide audit services for an additional year, Fiscal Year 2022-23, for an amount not to exceed $149,951. In accordance with Municipal Code Section 2.56.110.H.2, Impractical or Impossible, when it is determined by the Purchasing Agent (for contracts with a maximum contract amount of $100,000 or less) or by resolution of the City Council (for contracts with a maximum contract amount in excess of $100,000) that the competitive bidding requirements are impractical, or impossible, or that City interests would be materially better served by applying a different purchasing procedure, the Purchasing Agent or City Council, respectively, may award the contract utilizing alternative procedures consistent with best purchasing practices. The California Government Code Section 12410.6 (b) mandates that the engagement partner on a financial audit be rotated every six (6) years. This section states, commencing with FY 2013-14, a local agency shall not employ a public accounting firm to provide audit services to a local agency if the lead audit partner or coordinating audit partner having primary responsibility for the audit, or the audit partner responsible for reviewing the audit, has performed audit services for that local agency for six consecutive fiscal years. For purposes of calculating the six consecutive fiscal years, the local agency shall not take into account any time that a public accounting firm was employed by that local agency prior to FY 2013-14. The Controller may waive this requirement if he or she finds that another eligible public accounting firm is not available to perform the audit. Based on Section 12410.6 (b), LSL and the City are in compliance with this code. LSL partner Rich Kikuchi was the lead audit partner from FYs 2014-15 through 2017-18, Brandon Young was transitioned to the lead audit partner for FYs 2018-19 and 2019-20, and Ryan Domino was transitioned to Page 407 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 3 the lead audit partner for FYs 2020-21 and 2021-22 and will continue to be the lead audit partner for FY 2022-23. LSL is a regional, full-service firm with offices in Brea (headquarters), Laguna Hills, Santa Ana, and Sacramento, California, and The Woodlands, Texas. Established in 1929, LSL has grown as a leader in the governmental auditing industry. The firm has 135 employees including 14 partners. Their governmental staff consists of three partners, two senior managers, three managers, two supervisors, four seniors, and ten professional staff. The engagement with the City will be staffed from their Brea office. Current local clients to the City of Chula Vista include the City of Oceanside and the City of Carlsbad. DECISION-MAKER CONFLICT Staff has reviewed the decision contemplated by this action and has determined that it is not site-specific and consequently, the real property holdings of the City Council members do not create a disqualifying real property-related financial conflict of interest under the Political Reform Act (Cal. Gov't Code § 87100, et seq). CURRENT-YEAR FISCAL IMPACT The contract is budgeted in the General Fund in the current fiscal year. ONGOING FISCAL IMPACT All costs incurred for these services are budgeted in the General Fund annually. ATTACHMENTS 1. Sixth Amendment 2. Agreement Staff Contact: Sarah Schoen, Director of Finance/Treasurer Page 408 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Form Rev 3/6/2023 RESOLUTION NO. __________ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING THE SIXTH AMENDMENT TO THE AGREEMENT WITH THE ACCOUNTING FIRM OF LANCE, SOLL AND LUNGHARD, LLP TO PROVIDE AUDIT SERVICES WHEREAS, Section 1017 of the Chula Vista Charter requires an annual independent audit of the City: and WHEREAS, in 2014 the Finance Department posted a Request for Proposal (“RFP”) to provide auditing services to the City for Fiscal Years 2014 through 2018. Based on that solicitation the City Council approved the agreement with Lance, Soll and Lunghard, LLP (LSL); and WHEREAS, due to time constraints and conflicting priorities caused by staff changes, the Finance Department requested, and the City Council approved to contract with LSL to complete audit services for Fiscal Years 2021 and 2022; and WHEREAS, due to the Finance Department transitioning the preparation of the Annual Comprehensive Financial Report (ACFR) by LSL to the Finance Department internal staff, the Finance Department is requesting approval to contract with LSL to complete audit services for Fiscal Year 2023; and WHEREAS, in accordance with Municipal Code Section 2.56.110.H.2, the Purchasing Agent has determined that the City’s competitive bidding requirements are impractical with respect to this agreement, and that the City’s interests would be materially better served by continuing to utilize the services of LSL pursuant to the prior RFP. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it approves the amendment to the agreement between the City and Lance Soll and Lunghard, LLP, in the form presented, with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Attorney, and authorizes and directs the City Manager to execute same, and that it waives the competitive bidding requirements with respect to the retention of LSL for this work, as complying with such requirements would be impractical and the City’s interests would be better served by waiving those requirements. Presented by Approved as to form By: Sarah Schoen Jill D.S. Maland Director of Finance/Treasurer Lounsbery Ferguson Altona & Peak Acting City Attorney Page 409 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-038 Consultant Name: Lance Soll and Lunghard, LLP SIXTH AMENDMENT TO AGREEMENT BETWEEN THE CITY OF CHULA VISTA AND LANCE SOLL AND LUNGHARD, LLP TO PROVIDE AUDIT SERVICES This Sixth Amendment is entered into effective as of June 1, 2023 (“Effective Date”) by and between the City of Chula Vista (“City”), a California chartered municipal corporation, and Lance Soll and Lunghard, LLP, a California limited liability partnership (“Consultant”), with reference to the following factual recitals: A. The City and Consultant entered into the “Agreement Between the City of Chula Vista and Lance Soll and Lunghard, LLP to Provide Audit Services” (“Agreement”) on April 8, 2014. B. Pursuant to the Agreement, Consultant was to perform audit services for the City for fiscal years 2014-15 and 2015-16. C. The Agreement authorized the City Manager to approve additional services that may be required of Consultant at the hourly rates set forth in the Agreement, and to exercise two one-year options to extend the Agreement to cover fiscal years 2016-17 and 2017-18. D. The parties amended the Agreement in June 2015 to add additional services to be performed by Consultant for fiscal years 2014-15 and 2015-16 (“First Amendment”). E. The parties amended the Agreement in July 2016 to add additional services to be performed by Consultant for fiscal years 2016-17 and 2017-18 (“Second Amendment”). F. The parties amended the Agreement in June 2019 to add additional services to be performed by Consultant for fiscal year 2018-19 (“Third Amendment”). G. The parties amended the Agreement in June 2020 to add additional services to be performed by Consultant for fiscal year 2019-20 (“Fourth Amendment”) H. The parties amended the Agreement in June 2021 to provide that Consultant will perform the services under the Agreement for fiscal years 2020-21 and 2021-22. (“Fifth Amendment”) I. The parties desire to amend the Agreement to provide that Consultant will perform the services under the Agreement for fiscal year 2022-23. NOW, THEREFORE, in consideration of the above recitals and the mutual obligations of the parties set forth herein, City and Consultant agree as follows: 1. Section 8.D., of Exhibit A to the Agreement is amended to add the following at the end of the Section: “Consultant shall also complete the work for fiscal year 2022-23. The scope of work for Page 410 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-038 Consultant Name: Lance Soll and Lunghard, LLP the additional year shall include: (i) the work identified in sections 7. and 8.A. of Exhibit A to the Agreement, as amended; (ii) the services identified in paragraph 2 of the Second Amendment to the Agreement, and the services identified in paragraph 3 of the Third Amendment to the Agreement.” 2. Consultant shall be compensated in the amount not to exceed $149,951 for the satisfactory performance of the services described in paragraph 1, above, for fiscal year 2022-23. The compensation schedule will be as provided in section 10.A. of Exhibit A to the Agreement. 3. Except as specifically provided in this Amendment, the Agreement shall remain in full force and effect. [End of Agreement; Next Page is Signature Page] Page 411 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-038 Consultant Name: Lance Soll and Lunghard, LLP SIGNATURE PAGE TO SIXTH AMENDMENT TO AGREEMENT BETWEEN CITY OF CHULA VISTA AND LANCE SOLL AND LUNGHARD, LLP FOR AUDIT SERVICES IN WHITNESS WHEROF, by signing below the parties hereto enter this Sixth Amendment as of the Effective Date. CITY OF CHULA VISTA LANCE SOLL AND LUNGHARD, LLP By: _________________ By: ____________________ Maria Kachadoorian Ryan Domino City Manager Partner Approved as to form By: _________________ Jill D.S. Maland Lounsbery Ferguson Altona & Peak LLP Acting City Attorney Page 412 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 413 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 414 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 415 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 416 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 417 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 418 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 419 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 420 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 421 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 422 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 423 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 424 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 425 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 426 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 427 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 428 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 429 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 430 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 431 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 432 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 433 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 434 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 435 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 436 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 437 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda v.003 Page | 1 May 16, 2023 ITEM TITLE Agreements: Approve a Form of Agreement with Touchstone Golf, LLC for Management of the Chula Vista Golf Course and Authorize the City Manager to Enter into an Agreement with Huntington National Bank for the Lease of 80 Golf Carts Report Number: 23-0046 Location: Chula Vista Golf Course at 4475 Bonita Road Department: Economic Development Environmental Notice: The activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. Recommended Action Adopt resolutions A) Approving a form of agreement with Touchstone Golf, LLC for professional management services for the Chula Vista Golf Course (form of agreement is attached to the resolution and incorporated in the resolution as Exhibit 1); and B) Authorizing the City Manager to enter into a lease agreement with Huntington National Bank for the lease of 80 golf carts at a cost of $547,296, which will be funded by Touchstone Golf, LLC, as provided for under the agreement between the City and Touchstone Golf, LLC. SUMMARY On November 2, 2016 the City approved an agreement with Touchstone Golf, LLC to manage the Chula Vista Municipal Golf Course. The original agreement was for a one-year period with a provision to extend for an additional year, which was exercised by staff. In 2018, the City entered into a five-year agreement with Touchstone Golf, LLC to continue to manage the Golf Course. The term of that five-year agreement is due to expire on October 31, 2023. Since Touchstone Golf, LLC has taken on management of the Golf Course in 2016 it has continued to make physical improvements to the facility, improving the quality of the golf experience. Additionally, Touchstone Golf, LLC has improved the financial position of the City’s asset and has managed to increase patronage and revenues even through the COVID-19 pandemic. Staff recommends the City Council enter into another five-year agreement with Touchstone Golf, LLC to manage the Golf Course through 2028, with an option to extend the agreement for an additional five-year term through 2033. Additionally, Page 438 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 2 the existing lease for 80 golf carts at the Golf Course expires coterminous with the expiration of the existing management agreement with Touchstone Golf, LLC. As a result, staff recommend entering into a five-year lease with Huntington National Bank for the lease of 80 new E-Z-GO golf carts through 2028. ENVIRONMENTAL REVIEW The Director of Development Services has reviewed the proposed activity for compliance with the California Environmental Quality Act (CEQA) and has determined that the activity is not a “Project” as defined under Section 15378 of the State CEQA Guidelines because the proposed activity consists of a governmental fiscal/administrative activity which does not result in a physical change in the environment; therefore, pursuant to Section 15060(c)(3) of the State CEQA Guidelines, the activity is not subject to CEQA. Thus, no environmental review is required. BOARD/COMMISSION/COMMITTEE RECOMMENDATION N/A DISCUSSION In 1984, the City entered into a lease agreement with American Golf Corporation for the Chula Vista Golf Course that afforded the City a long-term management solution with a steady stream of revenue. It also required very little input or resources from the City. Conversely, it provided the operator with very little incentive to maintain the facility at a high level and no incentive to perform upgrades. As a result, the facility fell behind standards and had serious problems resulting from deferred maintenance of the facility. In November 2016 after staff review of the facility and the terms of the lease, staff recommended the transition of the facility from a lease agreement to a management agreement with Touchstone Golf, LLC. The management agreement allowed the City to have more control over the level of investment and management over the operations, which allowed flexibility to adapt to changing market conditions. The management model has provided the City more control over the operation and management of the Golf Course. Touchstone Golf, LLC’s one-year trial period began in 2016 and was extended by staff by an additional year based on Touchstone Golf, LLC’s successful management of the facility. Touchstone Golf, LLC’s management of the facility has resulted in physical improvements to the facility, an increase in the quality of the golf experience for customers and an improved financial position of the City’s asset. Touchstone Golf, LLC has been very responsive to the City’s direction and has shown creativity in addressing the various issues that have arisen. In 2018, the City Council approved a five-year facility management agreement for the Chula Vista Golf Course based on Touchstone Golf, LLC’s successful management of the facility for the previous two years. Additionally, Touchstone Golf, LLC has improved the financial position of the City’s asset and has managed to increase patronage and revenues even through the COVID-19 pandemic. The term of the current five-year agreement is due to expire on October 31, 2023. Touchstone Golf, LLC has continued to make improvements to the facility by working with staff to fund improvements that enhance the golfing experience, as well as the experience for community members wanting to use the facility as a meeting/gathering space. Improvements have been made to the 19th hole food and beverage operations. In the coming five years, the City and Touchstone Golf, LLC aspire to continue Page 439 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 3 improving the food and beverage amenities of the facility. Since taking over management of the Golf Course in 2016, Touchstone Golf, LLC has made $700,000 in capital improvements, including investing: $200,000 in new and used equipment; $75,000 in tee box repairs; and $100,000 in irrigation repairs. Since 2016, Touchstone Golf, LLC has hosted over 500 events or golf tournaments for local schools, non-profits and charities. Between July 1, 2020 and June 30, 2022 Touchstone Golf, LLC has generated approximately $1.1 million in net revenue from the Golf Course. Last year alone, Touchstone Golf, LLC generated $3.3 million in total revenue from the facility. As a result of Touchstone Golf LLC’s successful professional management of the Chula Vista Golf Course since 2016, staff recommends the City Council enter into another five-year agreement with Touchstone Golf, LLC to manage the Golf Course through 2028, with an option to extend the agreement for an additional five-year term through 2033. The proposed agreement includes an increase in the base management fee paid to Touchstone Golf, LLC. Whereas, the 2018 agreement established a $7,500 monthly base management fee paid to Touchstone Golf, LLC, the proposed base management fee for the next five years is $8,000 per month or $96,000 annually. In addition to the base management fee, Touchstone Golf, LLC is incentivized to continue to increase revenue generated from the golf course. The agreement also contains an Incentive Management Fee. In addition to the Base Management Fee, the incentive fee is based on the sustaining current revenue generated by operating the golf course. Specifically, if the Earnings Before Interest, Taxes and Amortization (EBITDA) is greater than or equal to $500,000, but less than $650,000, Touchstone Golf, LLC would receive an incentive fee of $15,000. If the EBITDA is equal to or greater than $650,000, Touchstone Golf, LLC would receive an incentive fee of $25,000. Finally, the existing lease for 80 golf carts that are currently located at the Golf Course expires coterminous with the expiration of the existing management agreement the City has with Touchstone Golf, LLC. Touchstone Golf, LLC maintains a close relationship with E-Z-GO and receives a corporate discount for the lease of E-Z-GO golf carts at a rate of 47%. The City identified a cooperative agreement through Omnia Partners Agreement (R210201) and in review of the options it was found that the pricing provided would be 2.5% higher than the discount offered by Huntington National Bank. Based on these unique reasons, staff is recommending that the City Council waive the normally applicable procurement selection process and enter into a lease agreement with Huntington National Bank on a “single source” basis as permitted under Sections 2.56.070B(3) and 2.56.070B(4) of the Chula Vista Municipal Code. As a result, staff recommends entering into a five-year lease with Huntington National Bank for 80 brand new electric E-Z-GO golf carts through 2028 at a cost of $547,296. In addition, the agreement between the City and Touchstone Golf, LLC requires that all obligations for maintenance and cost, including but not limited to return of the golf carts, repair, and stipulated loss of value, be borne by Touchstone Golf, LLC. Recommendation Staff recommends the City Council approve the form of agreement attached hereto as Attachment 1 for the City to enter into another five-year agreement with Touchstone Golf, LLC to manage the Golf Course through 2028, with an option to extend the agreement for an additional five-year term through 2033, by adopting the resolution provided therefor. Page 440 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 4 DECISION-MAKER CONFLICT Staff has reviewed the property holdings of the City Council members and has found no property holdings within 1,000 feet of the boundaries of the property which is the subject of this action. Consequently, this item does not present a disqualifying real property-related financial conflict of interest under California Code of Regulations Title 2, section 18702.2(a)(7) or (8), for purposes of the Political Reform Act (Cal. Gov’t Code §87100, et seq.). Staff is not independently aware, and has not been informed by any City Council member, of any other fact that may constitute a basis for a decision-maker conflict of interest in this matter. CURRENT-YEAR FISCAL IMPACT Given that the terms of the agreement with Touchstone Golf, LLC is proposed to begin in FY 2023/24, there is no current fiscal impact by adoption of these resolutions. Additionally, the lease with Huntington National Bank for 80 brand new electric E-Z-GO golf carts through 2028 at a cost of $547,296 will be funded through operating income generated by the golf course, as provided for under the agreement between the City and Touchstone Golf, LLC. ONGOING FISCAL IMPACT The management agreement with Touchstone Golf, LLC at a cost of $96,000 per year (plus any Incentive Fee), and the lease for the golf carts from Huntington National Bank at a cost of $547,296, are covered within the Golf Course’s operating budget for FY 2023/24 through FY 2028/29. The management agreement cost and lease cost will be funded through operating income generated by the golf course as provided for under the agreement between the City and Touchstone Golf, LLC. ATTACHMENTS 1. Agreement with Touchstone Golf, LLC for Professional Management Services for the Chula Vista Golf Course (Exhibit 1 to Resolution A) 2. Agreement with Huntington National Bank for the Lease of 80 Golf Carts Staff Contact: Kevin Pointer, Principal Economic Development Specialist Eric Crockett, Deputy City Manager Page 441 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41277478.2 RESOLUTION NO. __________ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING A FORM OF AGREEMENT WITH TOUCHSTONE GOLF, LLC FOR PROFESSIONAL MANAGEMENT SERVICES FOR THE CHULA VISTA GOLF COURSE WHEREAS, Chula Vista Municipal Code Section 2.56.110 authorizes the City of Chula Vista to enter into contracts for professional services; and WHEREAS, on November 1, 2016 the City Council approved a professional services agreement with Touchstone Golf, LLC to manage the Chula Vista Municipal Golf Course; and WHEREAS, the agreement was for a one-year term including a provision for a one-year extension; and WHEREAS, the agreement was extended and expired on November 31, 2008; and WHEREAS, on August 14, 2018 the City Council approved a Golf Course facility management agreement with Touchstone Golf, LLC for professional management services for the Chula Vista Golf Course through October 31, 2023; and WHEREAS, since 2016, Touchstone Golf, LLC has continued to make physical improvements to the facility, improving the quality of the golf experience and has improved the financial position of the City’s asset while managing to increase patronage and revenues even through the COVID-19 pandemic; and WHEREAS, based on the unique qualifications, staff is recommending that the City Council waive the normally applicable procurement selection process and enter into a Golf Course Facility Management Agreement with Touchstone Golf, LLC on a “single source” basis as permitted under Sections 2.56.070B(3) and 2.56.070B(4) of the Chula Vista Municipal Code; and WHEREAS, the City and Touchstone Golf, LLC desire to enter into a new five year agreement such that Touchstone Golf, LLC would continue to provide professional management services for the Chula Vista Golf Course through October 31, 2028, with an option to extend for an additional five years through October 31, 2033. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it hereby: 1. Finds with respect to the proposed Golf Course Facility Management Agreement between the City and Touchstone Golf, LLC for professional management services for the Chula Vista Golf Course (Facility Management Agreement), based on the facts set forth above, that City’s interests are better served by an alternative procurement Page 442 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda mechanism (per CVMC 2.56.070(B)(3)), and that Touchstone Golf, LLC is uniquely qualified to perform the proposed services (per CVMC 2.56.070(B)(4)), and therefore waives the City’s consultant selection process with respect to the Facility Management Agreement; and 2. Approves the form of Facility Management Agreement, attached hereto and incorporated herein as Exhibit 1, between the City and Touchstone Golf, LLC and authorizes the City Manager to enter into the Facility Management Agreement in substantially the form presented, with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Clerk. Presented by Approved as to form By: Eric C. Crockett Jill D.S. Maland Deputy City Manager/Director of Economic Lounsbery Ferguson Altona & Peak Development Acting City Attorney Page 443 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069/41247054.1 RESOLUTION NO. _______ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA AUTHORIZING EXECUTION AND DELIVERY OF A LEASE AGREEMENT AND APPROVING RELATED DOCUMENTS AND ACTIONS WHEREAS, the City of Chula Vista (the “City”) desires to lease new golf carts and is proceeding to finance the lease of said golf carts and related items (the “Property”) as referenced in the Lease Agreement (defined below); and WHEREAS, in order to obtain the Property, the City has proposed to lease the Property from The Huntington National Bank (the “Lessor”) pursuant to the terms of a Lease Agreement (the “Lease Agreement”), by and between the City, as lessee, and the Lessor; and WHEREAS, the City is authorized to enter into lease agreements for equipment pursuant to Sections 37350 and 37351 of the California Government Code; and WHEREAS, the City Council of the City (the “City Council”) wishes at this time to authorize and approve all proceedings for the leasing of the Property, the Lease Agreement, and all related documents and actions in furtherance of the public purposes of the City. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, as follows: SECTION 1. Recitals. The foregoing recitals are true and correct and the City Council so finds and determines. SECTION 2. Authorized Officers. The City Manager, Assistant City Manager, the Mayor, or either of their designee (each, an “Authorized Officer”) are hereby each, acting alone, authorized and directed to execute and deliver the Lease Agreement and all related documents on behalf of the City (subject to making such changes to the Lease Agreement or any related documents as they deem necessary or appropriate). The Authorized Officers are further authorized and directed to consummate the transaction described herein, execute any documents or supplementary agreements necessary to secure possession and use of the Property, and to approve any amendments necessary to carry out the provisions of this authorizing Resolution. SECTION 3. Approval of Lease Agreement and Documents. The City Council hereby approves the leasing plan outlined herein. To that end, the City Council hereby approves each of the lease documents in substantially the respective forms as presented to the City Council at this meeting, together with any changes therein or additions thereto deemed advisable by an Authorized Officer, whose execution thereof shall be conclusive evidence of such approval. The Lease Agreement, by and between the City, as lessee, and the Lessor, whereby the City leases the Property under the terms thereof, and whereby the Lessor agrees to lease the Property to the City in consideration of the payment by the City of the rental payments provided thereunder; provided Page 444 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069/41247054.1 that (i) the total lease amount under the Lease Agreement shall not exceed $600,000, and (ii) the term of the Lease Agreement shall not exceed 6 years. An Authorized Officer is authorized and directed for and in the name and on behalf of the City to execute and attest the final form of the Lease Agreement and all related documents. The documents are hereby approved, subject to the adjustment by an Authorized Officer but not excess of the above limitations as to the lease term and total amount for the lease of the Property. SECTION 4. Official Actions. The Authorized Officers are each authorized and directed in the name and on behalf of the City to make, execute, and deliver any and all assignments, certificates, requisitions, agreements, notices, consents, leases, designations relating to bank qualification under Section 265(b)(3)(B) of the Internal Revenue Code of 1986, escrow agreements, and other instruments of conveyance, warrants, and other documents (which may also be subject to approval as to form by the City Attorney), which they or any of them might deem necessary or appropriate in order to consummate any of the transactions contemplated by the agreements and documents approved under this Resolution. SECTION 5. Effective Date. This Resolution shall take effect from and immediately after the date of its passage and adoption. Presented by Approved as to form By: Eric C. Crockett Jill D.S. Maland Deputy City Manager/Director of Economic Lounsbery Ferguson Altona & Peak Development Acting City Attorney Page 445 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069/41247054.1 Page 446 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 GOLF COURSE FACILITY MANAGEMENT AGREEMENT This Agreement (“Agreement”) is made this ____ day of ______ 2023, between Touchstone Golf, LLC (“TOUCHSTONE”), a Delaware limited liability company and The City of Chula Vista a municipal corporation in the county of San Diego, California. (“CITY”). TOUCHSTONE and CITY may be referred to herein individually as a “Party” and collectively as the “Parties”. A. CITY holds title to a parcel of real property (“Property”) including an (18) hole golf course and facility and other amenities known as the Chula Vista Golf Course. B. CITY is in need of a professional manager of the complete operation of the Golf Course Facility, including, but not limited to, accounting and administration of all receipts and disbursements, marketing and sales, supervision of all employees and maintenance of the golf course, clubhouse, related facilities and equipment. C. CITY desires that TOUCHSTONE provide the management and other services which are necessary for the operations of the Golf Course Facility in a professional manner with budgets and operations structured to attempt to accomplish CITY’s financial needs. D. TOUCHSTONE has agreed to provide such services on the terms and conditions herein contained. I. BASIC TERMS A. Basic Terms 1. Term: The “Term” of this Agreement shall commence on November 1, 2023 (the “Commencement Date”) and end on October 31, 2028 (“Completion Date”), unless terminated as provided herein. 2. Extension: Unless TOUCHSTONE or CITY provides the other Party with thirty (30) days written notice prior to the Completion Date of its intent for the Agreement to expire on the Completion Date, the CITY shall have the option to extend the Term of this Agreement one additional term, defined as a five-year increment (the “Extension”). If the CITY exercises its option to extend, the Extension shall be on the same terms and conditions contained herein except as otherwise explicitly provided herein. In order to exercise the option to extend the CITY shall give thirty (30) days written notice prior to the Completion Date to TOUCHSTONE of the CITY’S election to exercise the Extension. Notwithstanding Section VIII, if the Term is extended as provided above, either Party may thereafter terminate the Agreement for any or no reason by providing the other Party with thirty (30) days prior written notice of the effective date of the termination. The foregoing does not limit either Party’s right to terminate the Agreement as otherwise provided in this Agreement. 3. Full Management: The term “Full Management” shall mean the performance of all activities and services required to operate and maintain the Golf Course Facility, including but not limited to those identified in Section III of this Agreement. 4. Base Management Fee: The monthly fee for Full Management shall be eight thousand dollars ($8,000) per month ($96,000 per annum) (the “Base Management Fee”). The Base Management Fee includes all costs and expenses associated with regional and executive Page 447 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 2 - oversight by TOUCHSTONE, plus central accounting functions above the course level, excluding tax accounting. 5. Incentive Management Fee: In addition to the Base Management Fee as provided for above, TOUCHSTONE shall be eligible to be paid an incentive management fee (the "Incentive Management Fee") based on specified levels in Earnings Before Interest, Taxes, Depreciation and Amortization (“EBITDA”). The Incentive Management Fee for each Incentive Fee Period shall either be: EBIDTA less than $500,000 = $0 Incentive Management Fee EBITDA equal to or greater than $500,000, but less than $650,000 = $15,000 Incentive Management Fee EBITDA equal to or greater than $650,000 = $25,000 Incentive Management Fee As used herein, "Incentive Fee Period" shall mean a CITY fiscal year, beginning July 1st and ending on the following June 30th. In the event of CITY’s early termination of this Agreement pursuant to Section VIII that occurs prior to end of the end of the Incentive Fee Period of any year this Agreement is in effect, the Incentive Management Fee shall be calculated and, if eligible, paid, based on a pro-rated schedule of EBITDA for the interim period. In the event of a termination for cause, no Incentive Management Fee shall be due. For each calculation of the Incentive Management Fee, any amount paid and/or accrued shall be excluded from the calculation in order to determine the absolute improvement in EBITDA. 6. Golf Course Facility Description: The term, “Golf Course Facility” shall mean the eighteen (18) hole golf course facility and other amenities known as the Chula Vista Golf Course, including a clubhouse, restaurant, golf shop, practice facility, maintenance and storage facilities, and all improvements and business operations thereof or in connection therewith. 7. Golf Carts: CITY will provide for Golf Carts for use by TOUCHSTONE. CITY only accepts responsibility for costs related to the cost of insurance; and return of the golf carts if CITY selects to replace the Golf Carts with Golf Carts other than E-Z-GO after the term of the Golf Cart Lease Agreement between CITY and Huntington National Bank (“HUNTINGTON”), bearing Lease Number 008-0710854-107 and dated February 15, 2023, attached to this Agreement as Exhibit “C” and incorporated herein by reference (“Lease Agreement”). TOUCHSTONE shall be responsible for maintenance and upkeep of the Golf Carts, and shall ensure the Golf Carts meet any and all standards set forth in the Lease Agreement, including but not limited to the “Return Condition Standards” as defined in the Lease Agreement, and shall comply with or assist CITY in complying with all other terms of the Lease Agreement as applicable. Any expense billed to the Golf Course Facility for not meeting the “Return Condition Standards” at the end of the Lease Agreement, shall be the expense of TOUCHSTONE. TOUCHSTONE shall maintain the golf carts in accordance with E-Z-GO standards. Golf Cart maintenance and repair is an operating expense of the golf course. TOUCHSTONE shall not be responsible for a stolen Golf Cart that the City does not elect to replace. 8. Liquor License: During the Term of this Agreement, TOUCHSTONE agrees to hold the liquor license in its name. TOUCHSTONE agrees that it will transfer the liquor license to CITY’s assignee at the time of the expiration or termination of this Agreement for no additional consideration other than reimbursement of any costs incurred by TOUCHSTONE. Page 448 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 3 - TOUCHSTONE shall retain all Net Profits from the sale of alcoholic beverages at the Golf Course Facility; provided, however, that the Base Management Fee shall be reduced each month by the amount equal to the Net Profits retained by TOUCHSTONE for such month. As used herein, the term “Net Profits” shall mean the gross receipts attributable to the sale of alcoholic beverages at the Golf Course Facility less (i) employee salaries, other compensation and benefits, (ii) payments under equipment leases, (iii) costs incurred to purchase alcoholic beverages for service or sale, and (iv) any applicable state and federal taxes, but not specifically excluding TOUCHSTONE’S income taxes in respect of Net Profits retained by TOUCHSTONE pursuant hereto. 9. Addresses for Notices: All notices, demands, and requests to be sent to any Party shall be deemed to have been properly given or served if personally served or deposited in the United States mail, addressed to such party, postage prepaid, registered or certified, within return receipt requested, at the addresses identified below: IF TO TOUCHSTONE: Mr. Stephen T. Harker President and CEO Touchstone Golf, LLC 1052 Overlook Road Berkeley, California 94708 sharker@touchstonegolf.com Fax: (510) 315-0136 and, Mr. Douglas J. Harker Executive Vice President Touchstone Golf, LLC 11612 Bee Caves Road, Bldg. II, Suite 150 Austin, Texas 78738 IF TO CITY: Mr. Kevin Pointer Principal Economic Development Specialist City of Chula Vista 276 Fourth Avenue Chula Vista, CA 91910 kpointer@chulavistaca.gov and, Attention: City Attorney City of Chula Vista 276 Fourth Avenue Chula Vista, CA 91910 II. REPRESENTATIONS AND RESPONSIBILITIES Each party agrees to cooperate with the other and its officers, employees, agents and contractors in connection with this Agreement. III. POWERS AND RESPONSIBILITIES OF TOUCHSTONE Page 449 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 4 - A. CITY hereby appoints TOUCHSTONE to manage the Golf Course Facility and TOUCHSTONE hereby accepts such appointment on the terms and conditions herein contained in this Agreement. Without limiting the generality of the foregoing, TOUCHSTONE shall provide to CITY the management services more particularly set out in this Section III. B. TOUCHSTONE will operate the Golf Course Facility in a good, workmanlike and professional manner by: 1. Providing day-to-day management and oversight of operations of the 18 hole daily fee golf facility to ensure a quality experience for guests and residents. 2. Arranging for the employment of competent management that are trained in the necessary facets of golf course facility management, with sufficient experience in the Golf Course Facility industry to oversee management of the Golf Course Facility. 3. Arranging for the employment of a competent staff and deploying such staff and other resources to insure proper care of the buildings, grounds, and Golf Course Facility. 4. Managing all hiring, training and termination of all Golf Course Facility management and personnel, including administering all labor relations. It is understood that TOUCHSTONE shall maintain the current Golf Course Facility Manager. Any new general manager to be hired shall be subject to the approval of the CITY, not to be unreasonably withheld or delayed. Personnel of the Golf Course facility will become employees of TOUCHSTONE. 5. Overseeing the accounting process including planning and budgeting; daily and monthly sales reporting, producing monthly financial statements; processing all expenses for payment; reviewing monthly cash flow statements; bank account reconciliations, and procession payroll; 6. Preparing and maintaining accurately in all material respects the books, accounts, and records of the operations of the Golf Course Facility and all transactions related to the Golf Course Facility. 7. Overseeing the planning and implementation of all marketing programs, including developing and execution of membership sales, tournament/catering event sales, social media, email marketing, community outreach (included in marketing calendar), promoting the food and beverage operation, implementing pricing and revenue management techniques, and placing appropriate media/advertising. 8. Arranging for the purchase of such supplies and equipment as is reasonably necessary in order to operate the Golf Course Facility. 9. Maintaining the Golf Course Facilities in a condition consistent with the standards and quality levels defined in the calendar budget and business plan. 10. Coordinating with CITY in advance to cause the Golf Course Facility to operate in compliance with all applicable laws and regulations including without limitation, where applicable, TOUCHSTONE complying with the California Labor Code and all associated California regulations relating to public works and prevailing wages, including but not limited to paying local prevailing wage rates in accordance with Sections 1720 et seq., 1770 et seq., 1771, Page 450 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 5 - and 1773, and 1782, as amended, of the California Labor Code for public works construction contracts and public works contracts for alteration, demolition, repair, and /or maintenance work. 11. Overseeing all other matters reasonably necessary for the efficient performance of the operations in connection with the Golf Course Facility. 12. Carrying out duties in a proper and business-like manner and in compliance with all applicable local, state and federal laws, regulations and ordinances. 13. To the extent that TOUCHSTONE has existing business relationships, such as those with suppliers and contractors, the use of which will benefit the CITY and the operation of the Golf Course Facilities, TOUCHSTONE shall make use of those relationships for the purchase, of supplies and equipment, as needed, to operate the Golf Course Facility. 14. TOUCHSTONE has an existing foundation or relationship with a foundation, the Touchstone Golf Foundation (the “Foundation”), which organizes a group of volunteers at the golf course to support non-profit causes and raise donations for them. The volunteers also support the golf course by educating the golfers on pace of play and acting as greeters. TOUCHSTONE shall make use of the Foundation to enhance guest service, community outreach, and promote the Golf Course Facility. C. Subject to any provisions to the contrary herein contained, TOUCHSTONE may subcontract the whole or any part of the performance of its obligations and duties herein described to any wholly owned subsidiary of TOUCHSTONE, or to any other person, firm, or CITY approved by CITY. The subcontracting of the whole or any part of its obligations and duties as aforesaid shall not relieve TOUCHSTONE from liability for the performance of such obligations and duties before or after such contracting. D. For the term of this Agreement, TOUCHSTONE will carry reasonable amounts, as determined by CITY’s Risk Manager, of general liability insuring all Golf Course Facility assets and operations, and completed operations including Fire Legal Liability Sublimit of not less than $100,000. TOUCHSTONE will also provide other insurance coverage as it or CITY deems necessary and normal for the operation of the Golf Course Facility, including but not limited to worker’s compensation and automobile liability. Liquor liability insurance/DRAM shop insurance will only be required if TOUCHSTONE operates the food and beverage operation. To the extent available, all of the foregoing insurance policies shall name CITY and all of its officers, officials, employees, and agents as additional insureds. The cost of all insurance called for in this paragraph III D shall be the sole responsibility of CITY and premiums paid by TOUCHSTONE shall be paid or reimbursed from the Operating Account(s) of the Golf Course, as defined below. Notwithstanding the foregoing, CITY agrees to provide all property insurance with respect to structures, and business property owned by City. TOUCHSTONE shall carry Fire Legal Liability of not less than $100,000 per occurrence. Specific insurance coverage and limits are described in EXHIBIT B – TOUCHSTONE GOLF INSURANCE COVERAGE. E. Unless otherwise directed by CITY, all contracts and agreements that relate specifically to the Golf Course Facility shall be entered into by and in the name of CITY. No contract or agreement shall be entered into without CITY approval unless in accordance with the budget and terminable on 30-days’ notice. TOUCHSTONE shall provide CITY copies of all such contracts Page 451 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 6 - and agreements which are binding upon or obligate CITY within ten (10) business days of their execution. F. TOUCHSTONE shall approve and pay all operating expenses of the Golf Course Facility promptly, unless the amounts thereof are in dispute. In addition, TOUCHSTONE will calculate any moneys or fees due TOUCHSTONE in accordance with this Agreement. TOUCHSTONE is authorized to pay its fees and expenses owing under this Agreement from the bank account utilized to pay operating expenses for the Golf Course Facility. No director or officer of TOUCHSTONE shall have any interest in any concession at the Golf Course Facility or in any contract for the Golf Course Facility without approval by the CITY or its designee. CITY shall designate bank account(s) necessary to fulfill the payment of expenses (“Operating Account(s)”) and shall authorize TOUCHSTONE and Golf Course Facility employees, as necessary, to make deposits and authorize disbursements from the Operating Account(s), which authorization shall be presumed for individuals named on bank resolutions and/or signature cards. G. TOUCHSTONE does not give any general or specific guarantee as to the profitability of the Golf Course Facility, the attendance thereat or the revenues therefrom. H. Upon expiration of the term of this Agreement, or upon the prior termination of this Agreement, and in any year prior to such expiration or termination, TOUCHSTONE agrees and covenants to cooperate fully with CITY or CITY’s designated successor manager in the smooth and businesslike transfer of the operations of Golf Course Facility including but not limited to transfer of accounts, contracts, policies, licenses, permits, equipment and improvements in connection with the Golf Course Facility to CITY or CITY’s designees, except proprietary information or processes, including proprietary software, to which TOUCHSTONE has the sole or exclusive ownership rights (“Proprietary Property”). TOUCHSTONE shall clearly identify any Proprietary Property with such designations as “Confidential” or “Proprietary”. Furthermore, TOUCHSTONE agrees and covenants to execute all documents required or convenient to accomplish any such transfer in a timely, effective and efficient manner. On the expiration or on the termination of this Agreement for any reason, all Golf Course Facility property and interests therein, including cash, accounts, books, records, contracts; policies; licenses, permits and improvements in the Golf Course Facility property, except Proprietary Property and property rights the Parties have agreed shall be the property of TOUCHSTONE, will be promptly turned over to CITY and be the property of CITY. TOUCHSTONE shall execute and deliver to CITY all documents necessary to legally effectuate each of the transactions. Unless otherwise agreed in writing by the Parties hereto, TOUCHSTONE shall remove its personnel and personal property from the Golf Course Facility upon such expiration or termination. Upon such expiration or termination, TOUCHSTONE shall surrender to CITY all cash and other assets of the Golf Course Facility. A transitional fee of fifteen thousand dollars ($15,000) will be paid by the CITY to TOUCHSTONE to cover the transition, wind down, and final accounting. I. TOUCHSTONE shall not make, or suffer to be made, any alterations of the Golf Course Facility or any part thereof if the cost of such alteration in the aggregate would be in excess of ten thousand dollars ($10,000) unless already included within the then approved budget for the Golf Course Facility without the prior written consent of CITY. TOUCHSTONE shall keep the Golf Course Facility premises and CITY’s property in which such premises are situated free from any liens arising out of any work performed or material furnished to the property. In the Page 452 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 7 - event such liens are placed, TOUCHSTONE shall immediately inform the CITY of the lien(s) and remove such liens as soon as reasonably possible. J. TOUCHSTONE shall not discriminate against any employee or applicant for employment because of race, color, creed, sex, age, national origin or non-disqualifying handicap. TOUCHSTONE shall not discriminate because of race, religion, color, ancestry, sex, national origin or non-disqualifying handicap against any person by refusing to furnish such person any service or privilege offered to or enjoyed by the general public, nor shall TOUCHSTONE or its employees publicize the Golf Course Facility in any manner that would directly or inferentially reflect on the acceptability of the patronage of any person because of race, religion, color, ancestry, sex, national origin or non-disqualifying handicap, nor shall the Golf Course Facility be so used. IV. MANAGEMENT COMPENSATION Payments for services under this Agreement shall be made as follows: 1. The Base Management Fee set forth in Section I shall be due and paid to TOUCHSTONE, upon issuance of the income statement for the month. 2. The Incentive Management Fee, if earned, shall be due and payable within thirty (30) days of the City’s approval of the financial statement for the prior twelve (12) month period consisting of a CITY fiscal year as described in Section I.A.5. V. PLANNING AND BUDGETS No later than March 1st of each year, TOUCHSTONE and CITY shall have prepared and received CITY’s approval of the annual budget (which shall include a line item budget by month of all revenue, costs of goods, operating expenses, payroll costs, management expenses, and other expenditures necessary for Full Management of the Golf Course Facility), marketing calendar, capital improvement plan, facility improvement plan, and equipment plan (collectively, the “Annual Budget”). Until such time that the Annual Budget is complete and approved by CITY, TOUCHSTONE shall use its best commercially reasonable efforts to operate the Golf Course Facility under the existing budget framework provided by TOUCHSTONE to CITY or in a manner consistent with the current market position of the Golf Course Facility. The capital improvement plan, facility improvement plan and equipment plan shall be reviewed by CITY to identify expenses, if any, to be excluded from the EBITDA calculation. VI. RECORDS, ACCOUNTS AND REPORTS A. TOUCHSTONE shall accurately in all material respects prepare and maintain the books, accounts, and records of the operations of the Golf Course Facility and all transactions related to the Golf Course Facility, in accordance with the Generally Accepted Accounting Principles (GAAP and City’s financial policies). B. TOUCHSTONE shall prepare monthly financial statements including a balance sheet, statement of operations and other financial data reasonably requested by CITY no later than twenty five (25) calendar days following the end of each month. TOUCHSTONE is not responsible for the preparation of the annual tax return of the Golf Course Facility. Page 453 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 8 - C. TOUCHSTONE shall utilize CITY’s capitalization and depreciation/amortization policy in the preparation of TOUCHSTONE’s monthly financial statements. TOUCHSTONE shall provide a listing of all capital improvements and capital equipment purchases monthly. D. CITY shall have the right, upon request, to examine all books and records and to, at CITY’s expense, request an audit. E. TOUCHSTONE shall maintain all books and records until termination or expiration of this Agreement, at which time they shall be transferred to the CITY or CITY’s assignee in accordance with the terms of this Agreement. VII. PAYMENT AND REIMBURSEMENT OF EXPENSES A. TOUCHSTONE shall be entitled to reimbursement from CITY for those reasonable costs and expenses of maintaining, operating, and supervising the operating and supervising the operation of the Golf Course Facility, provided they are in accordance with the contracts and consistent with the approved budget or within permitted variances provided for elsewhere in this Agreement, to include, but not limited to the following: 1. The salaries, fringe benefits, workers compensation insurance and expenses of employees; 2. All costs and expenses of any advertising or business promotion; 3. Costs of goods sold, including inventory and supplies necessary to conduct the business of the Golf Course Facility; 4. All expenditures for capital expenditures, repairs and maintenance, equipment and supplies; 5. Premiums for insurance maintained; 6. All expenses of regulatory compliance, permits, etc., it being specifically agreed that legal fees incurred in connection with regulatory compliance for such liquor licenses, food service, etc. are approved, reasonable and necessary legal fees of attorney’s retained by CITY or otherwise approved by CITY in advance, directly related to the operation and protection of the Golf Course Facility and CITY’s and TOUCHSTONE’s liability; 7. Cost and expenses of utilities; 8. General and administrative and accounting costs, including forms and checks; 9. Preapproved consulting fees for certain expertise (e.g. agronomy) needed to address specific needs of the Golf Course Facility; and 10. Accounting Fees (e.g. banking fees, electronic bill pay system fees, etc.), Incentive Management Fees and reimbursable expenses (e.g. travel for non-course based support team) of TOUCHSTONE as set forth herein. Page 454 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 9 - B. CITY is responsible for providing sufficient funds to cover the operating expenses for the Golf Course Facility. TOUCHSTONE, acting as authorized independent contractor for CITY, will deposit all revenues of the Golf Course Facility into an Operating Account(s) or accounts for the Golf Course Facility and TOUCHSTONE will have authority to draw upon the funds in the Operating Account(s) to cover operating expenses. In the event that funds in the Operating Account(s) are not sufficient to cover operating expenses, TOUCHSTONE shall advise CITY of the shortfall or potential shortfall and CITY shall deposit additional funds into the appropriate account in a timely manner in order to ensure that sufficient funds are available to meet the operational requirements of the Golf Course Facility. Touchstone will have no obligation to contribute funds to the Operating Account(s) of the Golf Course Facility. C. TOUCHSTONE may cause the Golf Course Facility to incur any expense (i) that is included in the approved Annual Operating Budget; (ii) that is needed to remedy any emergency situation that, in TOUCHSTONE’s professional judgment, is potentially hazardous, unsafe or damaging to the Golf Course Facility or to persons reasonably expected to be present at the Golf Course Facility (e.g., employees, patrons, authorized visitors) (“Emergency Expenditure”), as more particularly set forth hereinabove; or (iii) as otherwise expressly approved by CITY. TOUCHSTONE shall not incur any expense that is not consistent with the Annual Operating Budget without the consent of the CITY, except in the case of an emergency (as elsewhere provided in this Agreement) or as otherwise provided in this Agreement. TOUCHSTONE shall not enter into any contract, even if otherwise authorized hereunder, which binds or purports to bind CITY or the Golf Course Facility without the prior written approval of CITY if the term of such contract exceeds the Term unless such contract is terminable on 30 days’ notice. Excepting only Emergency Expenditures or expenditures included in the approved budget, TOUCHSTONE shall not incur any single expense, even if otherwise authorized hereunder, which is chargeable to CITY or to the Golf Course Facility if the amount equals or exceeds ten thousand dollars ($10,000). D. TOUCHSTONE may reallocate up to twenty five percent (25%) of any amount budgeted with respect to any one line item in the Annual Operating Budget to another line item budgeted therein, provided that the aggregate expenditures in the Annual Budget are unaffected. Unbudgeted minor expenditures unforeseen at the time of preparation of the Annual Budget, and reasonably deemed necessary by TOUCHSTONE, may be made without CITY authorization except that unbudgeted expenditures aggregating more than ten thousand dollars ($10,000) in any month, or more than fifty thousand dollars ($50,000) in any year, may not be made without CITY's written approval. VIII. TERMINATION A. The term of this Agreement shall be for the Term plus Extensions, if applicable. B. Notwithstanding the provisions of Section I, this Agreement may be terminated prior to the end of the Term plus Extensions, if applicable, as follows: 1. Mutual Consent: At any time by mutual agreement between TOUCHSTONE and CITY. 2. For Convenience: CITY may suspend or terminate this Agreement, at any time and for any or no reason, with or without cause, by giving specific written notice to TOUCHSTONE of Page 455 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 10 - such termination or suspension at least one hundred and eighty (180) days prior to the effective date thereof. 3. For Cause: Following a material breach of any of the terms and conditions of this Agreement, not amounting to gross negligence, the non-breaching party may terminate this Agreement following a written notice of breach and failure to cure as follows: Notice: The non-breaching party shall provide the other with written notice of the breach (the “Notice to Cure”). The Notice to Cure shall include sufficient detail to inform the nature of the alleged breach and shall indicate a date not less than fifteen (15) days from the date on the Notice to Cure by which the alleged breach shall be cured. Opportunity to Cure: The party accused of breach shall have an opportunity to cure the alleged breach within the timeframe provided in the Notice to Cure. In the event that a cure cannot be reasonably accomplished within the timeframe identified in the Notice to Cure, the party accused of the breach shall provide the other party with an explanation of why the cure cannot be accomplished within the timeframe provided, indicate a date by which the cure can be completed, and diligently pursue the cure to completion. 4. In the event of gross negligence in the operation of the Golf Course Facility by TOUCHSTONE, immediately upon receipt of written notice. Notice may be delivered personally, by e-mail, or by registered mail, or equivalent mail delivery service which provides for a signature of receipt. Page 456 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 11 - IX. MUTUAL INDEMNITY A. Indemnification by CITY of TOUCHSTONE CITY shall defend, indemnify, protect, and hold harmless the TOUCHSTONE, its officers, employees, agents, and affiliated entities, from and against any and all claims, demands, causes of action, costs, expenses, liability, loss, damage or injury, in law or equity, to property or persons, including wrongful death, in any manner arising out of or incident to any negligence or willful misconduct of CITY, its official, officers, employees and agents arising out of in connection with this Agreement. This indemnity provision does not include any claims, damages, liability, costs and expenses (including without limitations, attorneys fees) arising from the sole negligence, or willful misconduct of TOUCHSTONE, its officers, employees, agents or affiliated entities. B. Indemnification by TOUCHSTONE of CITY TOUCHSTONE shall defend, indemnify, protect, and hold harmless the CITY, its elected and appointed officers, agents and employees, from and against any and all claims, demands, causes of action, costs, expenses, liability, loss, fines, penalties, damages or injury, in law or equity, to property, including takings claims, or persons, including wrongful death, in any manner arising out of or incident to any alleged acts, omissions, negligence, or willful misconduct of TOUCHSTONE, its officers, employees, agents, or affiliated entities, arising out of or in connection with this Agreement, including the failure or alleged failure to pay prevailing wages as required by law or to comply with applicable provisions of the California Labor Code (including but not limited to Labor Code Sections 1720 et seq. and 1770 et seq.) and associated regulations. This indemnity provision does not include any claims, damages, liability, costs and expenses (including without limitations, attorneys fees) arising from the sole negligence, active negligence, or willful misconduct of CITY, its officers, employees, agents or affiliated entities. C. Enforcement Costs: To the extent that a party hereto is entitled to be indemnified (“Indemnitee”) by the other (“Indemnitor”) according to the provisions above, the Indemnitor agrees to pay any and all costs Indemnitee incurs enforcing such provisions. D. Survival. An Indemnitor’s obligations under Section IX shall survive the expiration and termination of this Agreement. X. REPRESENTATIONS AND WARRANTIES A. CITY represents and warrants to TOUCHSTONE as follows: 1. CITY is duly organized and validly existing under the laws of the state of its creation and is qualified to do business and is in good standing in the state in which the Golf Course Facility is located, with full power and authority to enter into and execute this Agreement and to consummate the transactions contemplated hereby. CITY has received all requisite partner or corporate approvals necessary for the execution and delivery of this Agreement and the consummation of the transactions contemplated hereby and this Agreement constitutes the legal, valid and binding obligation of CITY, enforceable against CITY in accordance with its terms, except as such enforceability may be limited by bankruptcy, insolvency, moratorium, Page 457 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 12 - reorganization or other similar laws affecting debtors’ and creditors’ rights generally and general equitable provisions. 2. To the best of the CITY’S knowledge, except as listed in Exhibit A, CITY has not received written notice from any governmental authority that the existing use, maintenance and operation of the Golf Course Facility or any portion thereof violates any law in any material respect. CITY has not received any written notice from any mortgagee, insurance company, fire marshal or building inspector requiring or requesting the performance of any work or alterations to the Improvements which has not been performed. 3. Except as set forth in Exhibit A, there are no actions, suits, or proceedings pending or, to the best of CITY’s knowledge, threatened in any court or before or by any governmental authority against or affecting the Golf Course Facility, except as disclosed in Exhibit A attached hereto and made a part hereof. 4. There are no pending eminent domain or condemnation proceedings against the Golf Course Facility or any part thereof and to the best of CITY’s knowledge, no such proceedings are presently threatened or contemplated by any authority with the power of eminent domain. 5. The CITY is not aware of any contracts or other obligations outstanding for the sale, exchange or transfer of the Golf Course Facility or any portion thereof. B. TOUCHSTONE represents and warrants to CITY as follows: 1. TOUCHSTONE is duly organized and validly existing under the laws of the state of its creation as a Delaware limited partnership, and is qualified to do business and is in good standing in the state in which the Golf Course Facility is located, with full power and authority to enter into and execute this Agreement and to consummate the transactions contemplated hereby. TOUCHSTONE has received all requisite partner or corporate approvals necessary for the execution and delivery of this Agreement and the consummation of the transactions contemplated hereby and this Agreement constitutes the legal, valid and binding obligation of TOUCHSTONE, enforceable against TOUCHSTONE in accordance with its terms, except as such enforceability may be limited by bankruptcy, insolvency, moratorium, reorganization or other similar laws affecting debtors’ and creditors’ rights generally and general equitable provisions. XI. CONFIDENTIALITY A. TOUCHSTONE acknowledges and agrees that CITY is subject to the California Public Records Act and numerous other laws and regulations regarding transparency and public disclosure of information (collectively, “Public Disclosure Laws”). Nothing contained in this Agreement is intended to create an obligation of CITY that is or would be in conflict with any Public Disclosure Laws. Except as required by Public Disclosure Laws or a court of competent jurisdiction, each party at all times hereafter shall attempt to preserve the secrecy an confidentiality of all other party’s confidential information (as defined hereafter) as it relates to the operation of the other party’s golf facilities, shall not attempt to use or in any way appropriate the same for its own use or benefit and shall not knowingly disclose or knowingly permit to be disclosed to any person (other than employees of CITY and TOUCHSTONE) confidential information without the prior written consent of the applicable party, except as required by law. Page 458 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 13 - Such consent shall not be unreasonably withheld. “Confidential information” means all information and data related to TOUCHSTONE, used by TOUCHSTONE in connection with TOUCHSTONE’s obligations hereunder and related to other tennis or Golf Course Facilities of TOUCHSTONE, which information and data relates to TOUCHSTONE trade secrets, ideas, know-how, improvements, inventions, technologies or internal business facts (including financial and operating information), except such information or data which is generally available to the public without CITY’s fault or its acquired in good faith by CITY from a third party who CITY has no reason to believe acquired the same in other than good faith and who is not under any obligation to TOUCHSTONE in respect thereof. B. TOUCHSTONE is permitted to identify its relationship with the Golf Course Facility in its advertising and marketing literature and website, including a photograph of the Golf Course Facility acceptable to CITY, with a generic reference stating that the Golf Course Facility, is a client (or upon expiration of the Term plus Extensions, if applicable, was a client) of TOUCHSTONE. XII. FORCE MAJEURE A. For the purposes of this Section XII, “force majeure” shall mean an act of God, strike, lockout or other industrial disturbance, act of a public enemy, war blockade, public riot, lightning, fire, storm, earthquake, flood, explosion, governmental restraint, breakage or accidents to equipment and any other cause, whether of the kind specifically enumerated above or otherwise, which shall not reasonably be within the control of the party claiming suspension. B. If TOUCHSTONE or CITY is unable, wholly or in part, by reason of force majeure (as herein defined) to carry out an obligation under this Agreement, such obligation shall be suspended so far as it is affected by such force majeure during the continuance thereof. The party unable to perform shall give the other party prompt notice of such force majeure with reasonably full particulars thereof and, insofar as is known, the probable extent to which it will be unable to perform or be delayed in performing such obligation. The party unable to perform shall use all possible diligence to remove such force majeure as quickly as possible. C. The requirement that any “force majeure” shall be removed with all possible diligence shall not require the settlement by the party unable to perform due to strikes, lockouts or other labor disputes or the meeting of any claims of or demands by any supplier or government entity contrary to the wishes of TOUCHSTONE or CITY or which may be harmful to CITY or to TOUCHSTONE. XIII. NO WAIVER No failure on the part of the CITY or TOUCHSTONE to insist upon the strict performance by the other of any covenant, term or condition of this Agreement, nor any failure to exercise any right or remedy consequent upon a breach of any covenant, term, or condition of this Agreement, shall constitute a waiver of any such breach of such covenant, term or condition. No waiver of any breach shall affect or alter this Agreement, and each and every covenant, condition, and term hereof shall continue in full force and effect to any existing or subsequent breach. XIV. AMENDMENTS Page 459 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 14 - This Agreement and the Exhibits and referenced incorporated into this Agreement fully express all understandings of the Parties concerning the matters covered in this Agreement. No change, alteration, or modification of the terms or conditions of this Agreement, and no verbal understanding of the Parties, their officers, agents, or employees shall be valid unless made in the form of a written change agreed to in writing by both Parties or an amendment to this Agreement agreed to by both Parties. All prior negotiations and agreements are merged into this Agreement. XV. SEVERABILITY A. If it is held by a court of competent jurisdiction that: 1. any part of this Agreement is void, voidable, illegal or unenforceable; or 2. this Agreement would be void, voidable, illegal or unenforceable unless any part of this Agreement were severed from this Agreement; then that part shall be severable from and shall not affect the continued operation of the rest of this Agreement. B. The provisions of Section XV (A) shall not apply if the part of the Agreement affected is a substantive part in which event the parties shall in good faith renegotiate the provisions of the part so affected. XVI. ASSIGNMENT A. This Agreement shall be binding on all parties hereto and their respective successors and assigns. B. A party shall not assign its rights and shall not be (except as provided herein) released from its obligations in, to, or under, this Agreement. XVII. COUNTERPARTS This Agreement may be executed in any number of counterparts, each of which, when so executed, shall be deemed to be an original and such counterparts shall together constitute an agreement. XVIII. NOTICES Any notice, document or other item to be given delivered, furnished or received under this Agreement shall be deemed given, delivered, furnished or received when given in writing and personally delivered to an officer of the applicable party, or, after same is deposited with the United States Postal Service, postage prepared, registered or certified first class mail, return receipt requested, addressed to such applicable part at the address or addresses as such party may from time to time designate by written notice to the other, at the time of delivery shown on such return receipt with the initial addresses being as set forth in the Basic Terms. XIX. MISCELLANEOUS A. All recitals herein are incorporated into this Agreement and are made part hereof. Page 460 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 15 - B. Time is of the essence of each covenant and condition set forth in this Agreement. C. The relationship between CITY and TOUCHSTONE is that of independent contractors, and except as herein expressly provided, neither party is granted any right or authority to assume or create any obligation or responsibility, express or implied, on behalf of or in the name of the other or to bind the other in any manner or thing whatsoever. D. The remedies provided herein for breach of this Agreement are not exclusive; and, in event of breach, the parties hereto have all the remedies provided by law. E. This Agreement is not intended and does not create any rights or interest in persons not a party hereto. F. Where the consent or approval of a party is required or necessary under this Agreement, the consent or approval shall be in writing and not be unreasonably withheld. G. Exhibits. Each of the following Exhibits is attached hereto and incorporated herein by this reference: Exhibit A: Known Litigation and Other Matters Exhibit B: Touchstone Golf LLC Insurance Coverage Exhibit C: Lease Agreement (Golf Carts) H. The Parties agree that they are aware that they have the right to be advised by counsel with respect to the negotiations, terms and conditions of this Agreement, and the decision of whether or not to seek advice of counsel with respect to this Agreement is a decision that is the sole responsibility of each Party. This Agreement shall not be construed in favor of or against either Party by reason of the extent to which each Party participated in the drafting of this Agreement. I. If an apparent conflict or inconsistency exists between the main body of this Agreement and the Exhibits, the main body of this Agreement shall control. If a conflict exists between applicable federal, state, or local law, rule, regulation, order, or code and this Agreement, the law, rule, regulation, order, or code shall control. Varying degrees of stringency among the main body of this Agreement, the Exhibits, and laws, rules, regulations, orders, or codes are not deemed conflicts, and the most stringent requirement shall control. Each Party shall notify the other immediately upon the identification of any apparent conflict or inconsistency concerning this Agreement. J. The Parties shall cooperate with each other in good faith, and assist each other in the performance of the provisions of this Contract. K. Further Assurances. CITY and TOUCHSTONE each agree to execute and deliver such additional documents as may be required to effectuate the purposes of this Agreement. L. The singular includes the plural and words importing one gender include the other gender. Page 461 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 16 - M. The headings in this Agreement are for convenience only and shall not affect its interpretation. XX. APPLICABLE LAW This Agreement is subject to the law of the state in which the Golf Course Facility is located and the Parties submit to the jurisdiction of the courts of that State. IN WITNESS WHEREOF, the Parties, have indicated their approval to the terms and conditions herein by the signatures below, and the Agreement shall be deemed executed on the date first hereinbefore written. TOUCHSTONE GOLF, LLC, a Delaware limited liability company By: Name: Stephen T. Harker Title: Chief Executive Officer CITY OF CHULA VISTA a Municipal Corporation By: Name: John McCann Title: Mayor ATTEST By: Name: Kerry K. Bigelow Title: City Clerk APPROVED AS TO FORM By: Name: Title: City Attorney Page 462 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 17 - Page 463 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 18 - GOLF COURSE FACILITY MANAGEMENT AGREEMENT LIST OF EXHIBITS Exhibit A: Known Litigation and Other Matters Exhibit B: Touchstone Golf LLC Insurance Coverage Exhibit C: Golf Cart Lease Agreement Page 464 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 19 - EXHIBIT A Known Litigation and Other Matters None Page 465 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 60297.00069\41273358.2 - 20 - EXHIBIT B Touchstone Golf LLC Insurance Coverage For the term of this Agreement, including any extensions, TOUCHSTONE GOLF LLC shall carry the following insurance, containing the limits and conditions described below: TOUCHSTONE will maintain commercial general liability insurance on standard ISO form CG 00 01, or equivalent, with limits not less than $1M per occurrence and $2M annual aggregate, and including Fire Legal Liability of not less than $100,000 per occurrence. TOUCHSTONE will maintain commercial auto liability insurance, including hired and non-owned auto liability, with limits not less than $1M combined single limit of liability. Should TOUCHSTONE be required to hold liquor license or otherwise become legally liable for liquor service, TOUCHSTONE will maintain liquor liability insurance with limits not less than $1M per occurrence.* The general liability, auto liability and liquor liability policies maintained by TOUCHSTONE shall name CITY as an additional insured and shall respond on a primary and non-contributory basis to claims of legal liability for which TOUCHSTONE is responsible. TOUCHSTONE will maintain a worker’s compensation policy for TOUCHSTONE employees in accordance with statutory requirements in the state where TOUCHSTONE is doing business or hires employees. TOUCHSTONE workers compensation policy shall contain employer’s liability limits of $1M each accident, $1M each disease each employee and $1M each disease – policy limit. TOUCHSTONE shall carry an umbrella policy with limits of $5M per occurrence and $5M annual aggregate, which follows form on the underlying general liability, auto liability, liquor liability and worker’s compensation policies. TOUCHSTONE general liability policy, auto liability policy, liquor liability policy and worker’s compensation policy shall contain a waiver of subrogation in favor of CITY. TOUCHSTONE shall give 30 days notice of cancellation to CITY in the event that a required policy will cancel during the term of this agreement. TOUCHSTONE will carry business income and extra expense coverage, where required, with limits agreed upon by TOUCHSTONE and CITY. Insurance for flood and earthquake are excluded from standard TOUCHSTONE insurance requirements. CITY’s Risk Manager may require TOUCHSTONE to carry updated or additional insurance requirements by giving TOUCHSTONE written notice of such requirements. TOUCHSTONE will make a diligent effort to comply with request from CITY to procure updated or additional insurance within thirty (30) days. * Liquor liability insurance/DRAM shop insurance will only be required if TOUCHSTONE operates the food and beverage operation. If food and beverage is operated by a third party concessionaire, the concessionaire will provide this insurance and name TOUCHSTONE as additionally insured. Page 466 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Huntington LEASE AGREEMENT (EQUIPMENT RENTAL) This "Lease": Lease Agreement Number 008-0710854-107 _____________, 2023 "Lessee" City of Chula Vista, CA, 276 4th Ave, Chula Vista, CA 91910 Fax: E-mail:cgilfillen@chulavistagc.com "Lessor" The Huntington National Bank, 11100 Wayzata Blvd, Suite 700, Minnetonka, MN 55305 Fax:319-833-4577 E-mail:customerservice@financediv.com Number of Rental Payments Rental Payments Advances 60 $9,121.60 (Plus any applicable taxes) First:$0.00 Last:$0.00 Total:$0.00 EQUIPMENT LOCATION & DESCRIPTION: MAXIMUM HOURS: Chula Vista Golf Course, 4475 Bonita Road, Bonita, CA 91902: (80)2023 RXV ELiTE together with all attachments N/A thereto TERMS AND CONDITIONS --READ CAREFULLY BEFORE SIGNING 1. RENTAL: Lessor rents to Lessee and Lessee rents from Lessor the equipment, furniture, fixtures, machinery, inventory, goods and software, as such terms are defined under the Uniform Commercial Code ("UCC"), described above and in any schedule made a part hereof, together with all replacements, replacement parts, repairs, returns, substitutions, additions, accessories, and accessions incorporated therein or attached thereto (collectively, "Equipment"), upon the terms and conditions set forth herein. The parties intend this Lease to be governed by Article 2A of the UCC. Pursuant to Article 2A, Lessee is entitled to the promises and warranties, including those of any third party, provided to Lessor by the Equipment supplier. Lessee may contact the Equipment supplier and receive an accurate and complete statement of the promises and warranties, including any disclaimers and limitations of them or of remedies. 2. PAYMENTS: Other than as set forth in a rider hereto, rental payments are due monthly, beginning the date designated by Lessor and provided in writing to Lessee, and shall continue on the same day of each month thereafter for the number of payments shown above. Security deposit is refundable upon expiration of this Lease provided all terms and conditions of this Lease have been fulfilled. Security deposit and payments may be commingled and do not earn interest. 3. EQUIPMENT ACCEPTANCE: Lessee shall have accepted the Equipment for purposes of this Lease upon Lessee's delivery of a signed delivery and acceptance certificate to Lessor. Lessee represents that any agent of Lessee who verifies delivery and acceptance of the Equipment, in writing, has actual authority to do so. Upon Lessor and Lessee’s acceptance of this Lease, and except as provided in this Lease including Section 19 hereof, THIS LEASE SHALL BE NON-CANCELABLE, and Lessee's obligations hereunder shall not abate for any reason. 4. DISCLAIMER OF WARRANTIES: THE EQUIPMENT IS BEING RENTED IN "AS IS" CONDITION. LESSEE AGREES THAT LESSOR IS NOT THE MANUFACTURER OR SUPPLIER OF THE EQUIPMENT. LESSEE HAS SELECTED THE EQUIPMENT BASED UPON ITS OWN JUDGMENT AND ACKNOWLEDGES THAT LESSOR HAS NOT MADE AND DOES NOT MAKE ANY REPRESENTATION OR WARRANTY OF ANY KIND, DIRECT OR INDIRECT, EXPRESS OR IMPLIED, AS TO THE SUITABILITY, DURABILITY, DESIGN, OPERATION OR CONDITION OF THE EQUIPMENT, ITS MERCHANTABILITY, FITNESS FOR USE FOR ANY PARTICULAR PURPOSE, OR OTHERWISE. No broker, equipment supplier, or other person (other than an employee of Lessor) is an agent of Lessor. 5. GOVERNING LAW; VENUE OF LITIGATION: THIS LEASE, AND ALL MATTERS ARISING FROM THIS LEASE, INCLUDING ALL INTEREST AND FINANCE CHARGES HEREUNDER, SHALL IN ALL RESPECTS BE GOVERNED BY AND CONSTRUED IN ACCORDANCE WITH CALIFORNIA LAW. TO THE EXENT PERMITTED BY LAW, LESSEE HEREBY WAIVES ITS RIGHT TO A JURY TRIAL. LESSOR OR ITS ASSIGNEE AT ITS SOLE DISCRETION MAY ENFORCE THIS LEASE IN ANY CALIFORNIA COURT HAVING LAWFUL JURISDICTION THEREOF. 6. SECURITY AGREEMENT: In the event this Lease is determined to be governed by Article 9 of the UCC, Lessee hereby grants Lessor a security interest in all Equipment financed by or rented from Lessor, of any kind or nature whatsoever, wherever located, whether now owned or hereafter acquired, and all returns, repossessions, substitutions, replacement parts, accessories, and accessions thereto and thereof, and all proceeds thereof, to secure all present and future obligations of Lessee to Lessor, of every type and description and howsoever evidenced. This Lease shall be construed so that interest, the applicable interest rate and other charges shall not exceed that allowed by applicable law, Page 467 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda and any payment that otherwise would be deemed unlawful will be applied first to prepay principal and then refunded to Lessee. 7. APPOINTMENT OF ATTORNEY IN FACT: Lessee authorizes Lessor, its successors and assigns to cause this Lease, or any other document(s) showing the interest of Lessor, including but not limited to UCC financing statements, to be authenticated and filed or recorded. In addition, Lessee appoints Lessor, its successors and assigns, as Lessee's attorney- in-fact (1) to arrange for property damage coverage under a policy of insurance and to transmit Lessee's premium payments to the insurer on behalf of Lessee, (2) to deal with and to direct any insurer as to any matter concerning the claim for, disposition of, and/or application of proceeds from any policy of insurance, and (3) to receive payments and execute and endorse all documents, checks, drafts, or other instruments necessary or advisable to secure payments due under any policy of insurance. These appointments and authorizations shall continue through the term of this Lease. Nothing in this paragraph shall relieve Lessee of its duty to procure required insurance, to make timely insurance claims, and to otherwise cooperate with insurance carriers and Lessor in seeking insurance coverage and recoveries. 8. UNCONDITIONAL OBLIGATION: Lessee agrees to be unconditionally obligated to pay all payments and other amounts due hereunder, except as expressly provided under this Lease, including Section 19 hereof no matter what happens, even if the Equipment is damaged or destroyed, if it is defective, if Lessee no longer can use it, or if the manufacturer or supplier ceases doing business or cannot service and/or support the Equipment, and irrespective of any set-off, counterclaim, defense, or other right which Lessee may have against Lessor or any other person. 9. USE: Lessee agrees that the Equipment will be used for its governmental purposes only and such use shall be in compliance with all applicable laws. Lessee shall maintain the Equipment in good repair and working order at Lessee's sole expense. 10. TAXES: Lessee agrees to pay all taxes, fees, and governmental charges related to this Lease, which during the term of this Lease or at any time thereafter may be imposed, provided, however, such amounts accrued during the Lease term. If Lessor pays any of the above for Lessee, Lessee agrees to reimburse Lessor on demand. Lessor shall not be obligated to contest any valuation of or tax imposed on the Equipment or this Lease. 11. INDEMNITY: To the extent permitted by law, Lessor is not responsible for any losses or injuries caused by the Equipment, and Lessee agrees to indemnify Lessor with respect to all claims for losses imposed on, incurred by, or asserted against Lessor, including attorneys' fees and expenses, where such claims in any way relate to the Equipment, whether or not caused in whole or in part by the negligence of Lessee, provided, however, Lessee shall not indemnify Lessor against Lessor’s own negligence or willful misconduct in connection with the Lease. Further, Lessee shall, if requested by Lessor, defend Lessor against any claims for losses or injuries caused by the Equipment, including but not limited to any claim arising out of strict liability in tort. This provision shall survive the cancellation, termination or expiration of this Lease. 12. INSURANCE: Lessee shall keep the Equipment insured against loss for not less than its replacement cost or such greater amount as may be prescribed by any applicable state law specifying minimum insurance requirements, and shall carry public liability insurance, both personal injury and property damage. Lessee shall name Lessor as an additional insured and as loss payee. If Lessee fails to procure insurance, Lessor may obtain same and pay the amount due thereon. Lessee shall reimburse Lessor upon demand and, if required by Lessor, shall pay interest on such sums due and owing at a rate of up to 5% per annum, but in no event more than the maximum rate permitted by law. With respect to any policy obtained by Lessor, Lessor may charge a monthly administrative fee. Any insurance proceeds received with respect to the Equipment will be applied, at the option of Lessor, to repair, restore, or replace the Equipment, or to pay Lessor the remaining balance and any other amounts payable hereunder. 13. LATE CHARGES: If Lessee is delinquent in paying any sum due, Lessee shall pay a charge to offset collection expenses on such delinquent payment of $25.00 or an amount of up to five percent (5%) of the payment amount that is past due, whichever is greater, but in no event more than allowed by applicable law. In addition, Lessor will impose a surcharge of up to $30 or the maximum allowed under applicable law for any dishonored payment. 14. DEFAULT: Any of the following constitute an event of default under this Lease: (1) Lessee fails to pay any sum due Lessor when due and payable; (2) Lessee fails to observe or perform any other term of this Lease; (3) Lessee encumbers or disposes of the Equipment without Lessor's written consent; (4) The filing by or against Lessee or any guarantor of Lessee's obligations to Lessor ("Guarantor") of a petition under the Bankruptcy Code or any other insolvency law; (5) The voluntary or involuntary commencement of any formal or informal proceeding for dissolution, liquidation, settlement of claims against or winding up of Lessee's or a Guarantor's affairs, or Lessee or a Guarantor, if applicable, ceases doing business of going concern; (6) Any representation or warranty made by Lessee or a Guarantor in connection herewith proves to have been materially misleading; (7) any Guarantor repudiates or attempts to revoke any guaranty of Lessee's obligations to Lessor related to this Lease. 15. REMEDIES: Upon an occurrence of default, Lessor may exercise one or more of the following remedies: (1) Declare due, sue for, and receive from Lessee the sum of all payments and other amounts then due and owing in the then-current fiscal year under this Lease or any schedule hereto, (2) Require Lessee to return the Equipment at its own expense to any reasonable location Lessor designates within the continental United States; or (3) Cancel or terminate this Lease or any other agreement between Lessee and Lessor; (4) Charge Lessee interest on all monies due hereunder from and after the date of default at the rate of 18% per annum, compounded monthly until paid in full, but in no event more than the maximum rate permitted by law; (5) Charge Lessee for any other amounts provided for in this Lease. In addition, Lessor may use any other remedies available to it under applicable law. These remedies will be applied, to the extent allowed by law, cumulatively. No delay in exercising any right or remedy shall operate as a waiver of any right or remedy or modify the terms of this Lease. A waiver of default shall not be construed as a waiver of any other or subsequent default. In addition to all of Lessor's other rights and remedies, Lessee agrees to pay Lessor all costs and Page 468 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda expenses, including attorneys' fees, incurred by Lessor in exercising or attempting to exercise any of its rights or remedies. If appropriate in the circumstances, remedies will include those available under Article 9 of the UCC. 16. ASSIGNMENT: Lessee may not sublet, lend, assign, or pledge this Lease, the Equipment, or any interest in either, or permit any lien or security interest thereon. Any and all of Lessor's interest and rights in the Equipment and under this Lease may be assigned, pledged, or otherwise disposed of, without notice to Lessee. Each assignee shall be entitled to exercise all rights and remedies of Lessor with respect to any and all obligations assigned to such assignee, and all references herein to "Lessor" shall include Lessor's assignee, except that said assignee shall not be chargeable with any obligations or liabilities of Lessor hereunder. Lessee will not assert against Lessor's assignee any defense, counterclaim or setoff on account of breach of warranty or otherwise in any action for payment or for possession brought by Lessor's assignee. Any assignment of this Lease by Lessee, whether or not permitted by Lessor, shall not release Lessee from its obligations hereunder. 17. RETURN OF EQUIPMENT: At the end of the term of this Lease, or if this Lease is terminated under Section 19 or as otherwise provided herein, Lessee must return the Equipment at its own expense, to Lessor or to a third-party designated by Lessor, and as applicable, the following must be true: All safety equipment must be in place and meet applicable federal, state and other governmental standards; All covers and guards must be in place with no sheet metal, plastic or cowling damage; All parts, pieces, components and optional equipment must be present, installed and operational; All accessories shall be returned in proper order; All motors shall operate smoothly without overheating and shall have good bearings and bushings; All electronic controls shall operate per manufacturers' specifications; Controls which bypass normal operations shall be repaired at Lessee's expense; All electrical systems shall be able to provide electrical output as specified by the manufacturer; All batteries shall be in good, safe operating condition with no dead cells or cracked cases; Batteries shall hold a charge and provide adequate power to operate the Equipment; All Equipment shall have serviceable tires, with 50% remaining tread, retaining proper air pressure, and without repair patches; All oil and grease seals must contain lubrication in the manufacturer's designed reservoir; All Equipment must have a relatively clean appearance; All Equipment must be free from excessive wear necessitating major component repair or replacement caused by lack of recommended maintenance detailed in Equipment operation/maintenance manuals, although normal wear and tear of the Equipment is acceptable; All Equipment shall be free from structural damage or bent frames; Any usage or metering devices must not have been altered in any way; All Equipment attachments, if any, must be in good operating condition; All hydraulic cylinders must not be bent, nicked, gouged or leaking. If the Equipment is an electric golf car, then in addition to the above return provisions: (i) the golf car must be able to transport two (2) people and their golf clubs; (ii) all batteries and battery terminals must be clean, free of corrosion and have proper battery water levels; and (iii) each golf car must include operable battery chargers. Additionally, all Equipment must be able to complete the following tests: operate normally in forward and reverse directions through all its speed ranges or gears, steer normally right and left in both forward and reverse, have all functions and controls work in a normal manner, be able to stop with its service brakes in a safe distance in both forward and reverse, operate without leaking any fluids, perform its designed functions in a satisfactory manner, and all cutting units (if applicable) must be able to lower, turn on, run, raise and shut off as they are designed to do, subject to normal wear and tear. If any Equipment is damaged or does not meet the standards set forth above for the return condition of such Equipment or if Lessee fails to discharge Lessee's obligations set forth under this Lease with regard to any Equipment, Lessee shall remit to Lessor, immediately upon demand, the Stipulated Loss Value of such Equipment. The "Stipulated Loss Value" for a particular piece of Equipment shall be an amount equal to: (i) the total of all monthly payments and other amounts, if any, due under the Lease with respect to such Equipment as of the date of payment of the Stipulated Loss Value, plus (ii) all rent not yet due for the Equipment for the remaining term of this Lease, discounted from their respective due dates at the rate of 3% per annum, plus (iii) the Equipment's "Anticipated Residual Value" as determined by Lessor's books as of the date of this Lease. Return Condition Standards applicable when the Equipment is Golf Cars. The Return Condition Standards for golf cars are as follows: (a) Equipment must start, stop, and turn properly; (b) Mechanically, all Equipment must be in operable condition upon return and capable of being driven onto a transporter; (c) Cosmetically, all Equipment and component parts are to be returned operable and complete according to the original state, reasonable wear and tear expected; (d) All equipment shall have serviceable tires, with 50% remaining tread, retaining proper air pressure, and without repair patches; (e) All gauges will be operative and all fluid levels to manufacturer's specifications; and, (f) if the Equipment is an electric golf car, then in addition to the other Return Condition Standards: (i) the golf car must be able to transport two (2) people and their golf clubs; (ii) all batteries and battery terminals must be clean, free of corrosion and have proper battery water levels; and, (iii) each golf car must include operable battery chargers. Any missing Equipment and parts or damage to the Equipment will result in a separate billing at replacement cost or fair market value. Failure to do so, and at Lessor's sole discretion, is a default under this Lease, and in all cases will result in automatic conversion of this Lease to a month-to-month rental agreement on the same terms. Conversion to a month-to-month rental agreement shall not operate to waive any of Lessor's rights herein. 18. REPRESENTATIONS AND WARRANTIES: Lessee represents and warrants to Lessor that as of the date hereof, and throughout the term of the Lease: (a) Lessee is a political subdivision of the state or commonwealth in which it is located and is organized and existing under the constitution and laws of such state or commonwealth; (b) Lessee has complied, and will comply, fully with all applicable laws, rules, ordinances, and regulations governing open meetings, public bidding and appropriations required in connection with the Lease, the performance of its obligations under the Lease and the acquisition and use of the Equipment; (c) the person(s) signing the Lease and any other documents required to be delivered in connection with the Lease (collectively, the "Documents") have the authority to do so, are acting with the full authorization of Lessee's governing body, and hold the offices indicated below their signatures, each of which are genuine; (d) the Documents are valid, legal and binding Leases, and are enforceable Page 469 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda against Lessee in accordance with their terms; and (e) the Equipment is essential to the immediate performance of a governmental or proprietary function by Lessee within the scope of its authority and will be used during the term of the Lease only by Lessee and only to perform such function. Lessee further represents and warrants to Lessor that, as of the date each item of Equipment becomes subject to the Lease and any applicable schedule, it has funds available to pay all Lease payments payable thereunder until the end of Lessee's then current fiscal year, and, in this regard and upon Lessor's written request, Lessee shall deliver in a form acceptable to Lessor a resolution or other action enacted by Lessee's governing body, authorizing the appropriation of funds for the payment of Lessee's obligations under the Lease during Lessee's then current fiscal year. 19. TERMINATION FOR GOVERNMENTAL NON-APPROPRIATIONS: To the extent permitted by applicable law, Lessee agrees to take all necessary and timely action during the Lease term to obtain and maintain funds appropriations sufficient to satisfy its payment obligations under the Lease (the "Obligations"), including, without limitation, providing for the Obligations in each budget submitted to obtain applicable appropriations, submitting for approval of such budget, and exhausting all available reviews and appeals if an appropriation sufficient to satisfy the Obligations is not made. Notwithstanding anything to the contrary provided in the Lease, if Lessee’s governing body does not appropriate funds sufficient to make all payments due during any fiscal year under the Lease (a "Non- Appropriation Event"), Lessee may terminate this Lease effective as of the end of Lessee's last funded fiscal year ("Termination Date") without liability for any future payments, penalty, or the early termination charge under this Lease, if any, by giving at least 60 days' prior written notice of termination ("Termination Notice") to Lessor. If Lessee terminates the Lease prior to the expiration of the end of the term of this Lease as permitted under the terms of this Lease or as set forth herein or in any schedule, Lessee shall (i) on or before the Termination Date, return the Equipment subject to the terminated Lease in accordance with the return requirements set forth in this Lease, (ii) provide in the Termination Notice a certification of a responsible official that a Non-Appropriation Event has occurred, (iii) deliver to Lessor, upon written request by Lessor, an letter of Lessee's counsel (addressed to Lessor) verifying that the Non- Appropriation Event as set forth in the Termination Notice has occurred, and (iv) pay Lessor all sums payable to Lessor under this Lease up to and including the Termination Date. Lessee acknowledges and agrees that, in the event of the termination of this Lease and the return of the Equipment as provided for herein, Lessee shall have no interest whatsoever in the Equipment or proceeds thereof and Lessor shall be entitled to retain for its own account the proceeds resulting from any disposition or re-leasing of the Equipment along with any advance rentals, security deposits or other sums previously paid by Lessee pursuant to the terms of the Lease. 20. DELIVERY OF CERTAIN DOCUMENTS AND RELATED REQUIREMENTS: Lessee will execute or provide, as requested by Lessor in writing, annual budget and financial information and such other documents and information, including an opinion of Lessee's counsel as to the validity and enforceability of this Lease, as are reasonably necessary with respect to the transaction contemplated by this Lease; provided, however, any such budget or financial information which is publicly available on Lessee’s website or elsewhere is deemed to have been provided to Lessor. If Lessee is a "Registered Organization" (as such term is defined in the UCC), then Lessee will: (i) upon request of Lessor, provide copies of its applicable registered organization documents; and (ii) not change its legal name or its chief executive office or state of organization, without, in each case, giving Lessor at least 30 days' prior written notice of any such event. 21. LESSEE WAIVERS: To the extent permitted by law, Lessee waives all rights and remedies against Lessor provided by Article 2A or Article 9 of the UCC or other applicable law, including but not limited to any right which requires Lessor to sell, lease, or otherwise use any Equipment to reduce Lessor's damages or which may otherwise limit or modify any of Lessor's rights or remedies. Any action against Lessor for any default, including breach of warranty or indemnity, must be started within one (1) year after the event which caused it. Lessor will not be liable for specific performance of this Lease or for any losses, damages, delay, or failure to deliver the Equipment. 22. GENERAL: This Lease may, in Lessor's sole discretion, be delivered and/or reproduced by facsimile, optical scanning or other electronic means ("e-copy") and such e-copy or a printed version thereof shall be enforceable as an original and admissible as such in any court or other proceeding, provided that there shall be only one original of this Lease and it shall bear the original ink or electronic signature of Lessor and be marked "Original." Each party's electronic signature on this Lease shall be unconditionally valid and legally enforceable, and each party agrees not to contest the validity or enforceability of any electronic signature (or the authority of the electronic signer to sign). To the extent that this Lease constitutes chattel paper (as that term is defined by the Uniform Commercial Code), a security or ownership interest intended to be created through the transfer and possession of this Lease can be done only by the transfer of the "Original" bearing the original ink or electronic signature of Lessor; provided that, if the "Paper Out" process shall have occurred, or if there shall simultaneously exist both the "Paper Out" printed version and an electronic version of this Lease, then the "Paper Out" printed version of such document bearing the legend "Original" applied by Lessor shall constitute the sole chattel paper original and authoritative version. If Lessor permit Lessee to deliver this Lease or any related document to Lessor via facsimile or other electronic means, Lessee shall deliver to Lessor, promptly on request, such document bearing Lessee's electronic or "wet ink" signature; provided that neither delivery nor failure to deliver the document bearing Lessee's electronic or "wet ink" signature shall limit or modify the representations and agreements set forth above. This Lease shall inure to the benefit of and is binding upon the parties and their heirs, personal representatives, successors, and assigns. This Lease represents the entire agreement between the parties, superseding all prior or contemporaneous negotiations, discussions, understandings, or agreements pertaining to the subject matter hereof. This Lease shall not be modified without each party’s written consent. If any provision of this Lease is deemed unenforceable, then such provision shall be deemed deleted and all other provisions Page 470 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda of this Lease shall remain in full force and effect. Any written notice hereunder shall be deemed given when delivered personally, deposited with a nationally recognized overnight courier (with all fees pre-paid), delivered via facsimile or email (with confirmation of transmission), or deposited in the United States mails, certified or registered mail, addressed to recipient at its address set forth above or such other address as may be substituted therefor by notice given pursuant to the terms hereof. Lessee hereby agrees that Lessor, including its vendors, service providers, partners, affiliates successors and assigns, may contact Lessee at any telephone number provided to Lessor, by placing voice telephone calls (including use of automatic telephone dialing systems or prerecorded voice messaging) or, in the case of wireless telephones or other wireless devices, by sending e-mail or automated (SMS) text messages. Lessee authorizes, and represents that all Lessee's principals have authorized, Lessor to obtain such credit bureau reports and make such other credit inquiries with respect to Lessee and such principals as Lessor deems appropriate throughout the term of this Lease. On written request, Lessor will identify any reporting agency used for such a report. Lessee agrees that Lessor may receive from and disclose, with written consent from Lessee, to other persons, including credit reporting agencies and respective equipment vendors and suppliers, information about Lessee's accounts and credit experience. Lessee shall execute and deliver to Lessor such other documents and provide such information, including information identifying the owners of Lessee and its affiliates and their respective ownership interests, as Lessor may reasonably deem necessary to comply with laws or regulations applicable to Lessor or Lessee, including laws and regulations requiring Lessor to obtain Lessee's certification of its beneficial owner(s) prior to making payment(s) to Lessee during or after the term of this Lease. Under federal law, Lessor must obtain, verify and record identifying information for each person opening an account. Lessor will ask for Lessee's name, address, date of birth and other identifying information. Lessor may also ask for Lessee's driver's license or other identifying documents. This Lease shall not be deemed terminated until Lessee has fulfilled all obligations herein. Time is of the essence for all purposes of this Lease. ADDITIONAL TERMS AND CONDITIONS Lessee acknowledges having read the terms and conditions printed above, and unconditionally agrees to same. Lessee requests that Lessor countersign this Lease and requests and hereby authorizes Lessor to pay the Equipment vendor/manufacturer. Lessor: The Huntington National Bank By: Title: Lessee: City of Chula Vista, CA By: Title: THIS LEASE IS NOT BINDING UNTIL ACCEPTED BY LESSOR AND LESSEE Page 471 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OPINION OF COUNSEL (To be on Attorney's Letterhead) Date: Lessee: Lessor: City of Chula Vista, CA 276 4th Ave, Chula Vista, CA 91910 The Huntington National Bank 11100 Wayzata Blvd, Suite 700 Minnetonka, MN 55305 Re: Contract 008-0710854-107, dated as of _________________, 2023, by and between City of Chula Vista, CA and Lessor Ladies and Gentlemen: I have acted as counsel to Lessee with respect to the contract described above (the "Lease") and various related matters, and in this capacity have reviewed a duplicate original or certified copy of the Lease and exhibit thereto. Based upon the examination of these and such other documents as I deem relevant, it is my opinion that: 1. Lessee is a public corporation and political subdivision of the State of California (the "State") duly organized, existing and operating under the Constitution and laws of the State. The full, true and correct legal name of Lessee is 2. The Uniform Commercial Code, as adopted in the State (the "UCC"), and no other statute of the State, governs the creation, perfection, priority or enforcement of a security interest created by Lessee. 3. Lessee is authorized and has power under State law to enter into the Lease, and to carry out its obligations thereunder and the transactions contemplated thereby. 4. The Lease and the other documents described above have been duly authorized, approved, executed and delivered by and on behalf of Lessee, and the Lease is a valid and binding contract of Lessee enforceable in accordance with its terms, except to the extent limited by State and Federal laws affecting remedies and by bankruptcy, reorganization or other laws of general application relating to or affecting the enforcement of creditors' rights. 5. The authorization, approval and execution of the Lease and all other proceedings of Lessee relating to the transactions contemplated thereby have been performed in accordance with all open meeting laws, public bidding laws and all other applicable State and Federal laws. 6. The execution of the Lease and the appropriation of moneys to pay the payments coming due under the Lease do not result in the violation of any constitutional, statutory or other limitation relating to the manner, form or amount of indebtedness which may be incurred by Lessee. 7. There is no litigation, action, suit, or proceeding pending or before any court, administrative agency, arbitrator or governmental body, that challenges the organization or existence of Lessee; the authority of the organization or existence of Lessee; the authority of its officers; the proper authorization, approval and execution of the Lease and the other documents described above; the appropriation of monies to make Rental Payments under the Lease for the current fiscal year, or the ability of Lessee otherwise to perform its obligations under the Lease and the transactions contemplated thereby. Page 1 Page 472 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda This opinion of counsel may be relied upon by Lessor and its successors and assigns. Very truly yours, Page 473 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda OD Huntington CERTIFICATE OF INCUMBENCY LEASE NO. 008-0710854-107 DATED AS OF February 15, 2023 I, ______________________________________________ , do hereby certify that I am the duly elected or appointed and acting Clerk of City of Chula Vista, CA (the "Lessee"), a political subdivision duly organized and existing under the laws of the State of California, and that, as of the date hereof, the individuals named below are the duly elected or appointed officers of the Lessee holding the offices set forth opposite their respective names. NAME TITLE SIGNATURE IN WITNESS WHEREOF, I have duly executed this certificate this ______ day of __________________ , 20 Signed: ____________________________________ Title: ______________________________________ NOTE: The City Clerk of the Lessee should sign unless that person is also the signor of the documents in which case the Mayor or some other Officer of the Lessee should execute this document. 1 Page 474 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Huntington Invoice Date of Invoice: 02/16/2023 Application Number: 498584 Contract Number: 008-0710854-107 To: City of Chula Vista, CA 276 4th Ave Chula Vista, CA 91910 Advance Payments/Security Deposit Contract Payment Sales/Use Tax Other Amount $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 Description First Payment in Advance Last Payment in Advance Sub Total $0.00 Other Fees/Charges Fee Description Amount Documentation Fee $200.00 Other Fees/Charges Sub Total $200.00 Invoice Total Due Invoice Total Due $200.00 Remit Payment with 866-465-3149 Completed Documents to: OR The Huntington National Bank 11100 Wayzata Blvd, Suite 700 Minnetonka, MN 55305 Page 475 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Huntington Delivery and Acceptance "Lessee" City of Chula Vista, CA, 276 4th Ave, Chula Vista, CA 91910 "Lessor" The Huntington National Bank, 11100 Wayzata Blvd, Suite 700, Minnetonka, MN 55305 Delivery and Acceptance agreement attached to and made a part of Lease 008-0710854-107 dated ______________, 2023 (the "Lease"). This Certificate relates to the Equipment (the "Equipment") that is described in the Lease. Pursuant to the Lease, Lessee acknowledges that Lessor has acquired the Equipment in connection with the Lease and Lessee has either received a copy of the purchase agreement with the vendor of the Equipment on or before signing the Lease or has approved such purchase. Lessee hereby represents, warrants and certifies that (i) all of the Equipment has been delivered to Lessee at the Equipment Location set forth in the Lease and has been installed, tested and inspected by Lessee or duly authorized representatives of Lessee, (ii) the Equipment Description set forth in the Lease is complete and correct, (iii) the Equipment, together with any supporting documentation, is exactly what Lessee ordered, is in good working order, is satisfactory in all respects and has been accepted by Lessee under the Lease as of the Acceptance Date set forth below, and (iv) there has been no adverse change in the business or financial condition of Lessee or any guarantor of the Lease since the day the most recent financial statement of Lessee or any guarantor was submitted to Lessor. If Lessee has made a deposit to the Equipment vendor(s), by signing this Certificate, Lessee hereby transfers all of Lessee's right, title and interest in and to the Equipment to Lessor, except to the extent set forth in the Lease, whether or not Lessee has been reimbursed for the deposit(s). IMPORTANT: LESSEE SHOULD SIGN THIS CERTIFICATE ONLY AFTER LESSEE HAS RECEIVED AND IS COMPLETELY SATISFIED WITH THE EQUIPMENT. BY SIGNING THIS CERTIFICATE, LESSEE (1) IS IRREVOCABLY ACCEPTING THE EQUIPMENT, (2) BECOMES ABSOLUTELY AND IRREVOCABLY OBLIGATED TO LESSOR UNDER THE LEASE, AND (3) MAY NOT THEREAFTER REJECT THE EQUIPMENT, CANCEL OR TERMINATE THE LEASE OR DENY ANY STATEMENT MADE IN THIS CERTIFICATE, FOR ANY REASON WHATSOEVER Acceptance Date: _______________________________ Lessee: City of Chula Vista, CA By: _____________________________________ Title: __________________________ Printed Name: Please Complete and return this document by Fax to 800-741-8079 upon delivery and acceptance of the financed Equipment. Page 476 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Huntington Insurance Certificate Request 11100 Wayzata Blvd, Ste 700, Minnetonka, MN 55305 To To Whom It May Concern From Jen Mattison Company Phone (614) 331-4932 Fax Email Jennifer.mattison@huntington.com Phone Subject INSURANCE CERTIFICATE REQUEST Date February 16, 2023 Message: Our mutual customer, City of Chula Vista, CA, is leasing equipment through The Huntington National Bank. We are in need of an INSURANCE CERTIFICATE for the equipment leased prior to us closing out their transaction. Please see below for specifics. Thanks! Please include the following items on the certificate: 1. INSURED: City of Chula Vista, CA, 276 4th Ave, Chula Vista, CA 91910 2. COVERAGES: x Liability Insurance — Minimum $1,000,000.00 per occurrence in Combined Single Limit or such greater minimum as may be prescribed by any applicable state law specifying minimum insurance requirements. ¾ Policy Number ¾ Policy Effective Date & Policy Expiration Date x Property Damage — Cost: $575,586.40 or ACV ¾ Comprehensive & Collision Deductibles (if applicable) or Physical Damage Deductible (Shall not exceed $10,000 or 10% of Total Cost) ¾ Policy Number ¾ Policy Effective Date & Policy Expiration Date 3. DESCRIPTION OF EQUIPMENT: (80)RXV ELiTE together with all attachments and accessories thereto Or reference: "Leased Equipment on HNB Contract Number 008-0710854-107", if the description is too long 4. The Huntington National Bank, its successors and assigns needs to be listed as Loss Payee & Additional Insured on the Insurance Certificate. If you have any questions, please feel free to contact me. Please send the certificate to my attention as soon as possible to Jennifer.mattison@huntington.com. Thank you! Jen Mattison Sales Coordinator The Huntington National Bank, 11100 Wayzata Blvd, Suite 700, Minnetonka, MN 55305 Page 477 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda v.003 Page | 1 May 16, 2023 ITEM TITLE Agreement: Accept Proposals and Award an Agreement with PSC Investigations LLC to Provide Background Investigative Services Report Number: 23-0126 Location: No specific geographic location Department: Police Environmental Notice: The activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. Recommended Action Adopt a resolution accepting proposals and awarding an agreement to PSC Investigations LLC to provide background investigative services. SUMMARY On March 10, 2023, the City of Chula Vista issued Request for Proposal (RFP) # P19-2023 for companies to provide background investigative services for the Police Department. After completion of the RFP process, staff is recommending awarding an agreement to PSC Investigations LLC to provide background investigative services. ENVIRONMENTAL REVIEW The Director of Development Services has reviewed the proposed activity for compliance with the California Environmental Quality Act (CEQA) and has determined that the activity is not a “Project” as defined under Section 15378 of the State CEQA Guidelines because it will not result in a physical change in the environment; therefore, pursuant to Section 15060(c)(3) of the State CEQA Guidelines, the activity is not subject to CEQA. Thus, no environmental review is required. BOARD/COMMISSION/COMMITTEE RECOMMENDATION Not applicable. Page 478 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 2 DISCUSSION As a result of existing staff vacancies and the ongoing recruiting needs of the Police Department, a large number of applicants are anticipated to go through a background investigation during the recruitment process. To efficiently manage the large volume of background investigations, the Police Department will continue to contract for background services for prospective law enforcement officers and civilian staff. On March 10, 2023, the City of Chula Vista issued Request for Proposal (RFP) # P19-2023 for companies to provide background investigative services for the Police Department. The table below represents the four respondents to the RFP: Table 1: RFP #P19-2023 RESPONDENTS Oracle Investigations Group LLC Professional Polygraphs and Backgrounds PSC Investigations LLC TruView BSI, LLC An evaluation team, consisting of the Professional Standards Unit (PSU) Lieutenant, PSU Sergeant, and PSU Sworn Background Investigator, reviewed the written proposals to evaluate their qualifications to provide background investigative services. After a comprehensive assessment, staff recommends awarding the agreement to PSC Investigations LLC to provide background investigative services for the Police Department. PSC Investigations LLC was chosen due to their ability to meet the Scope of Work requirements as detailed in the RFP; along with their methodology and approach to completing the required work, their business philosophy and ethical standards, their proven knowledge of current Peace Officers Standards and Training (POST) background investigation requirements, and their competitive pricing. The cost of PSC Investigations LLC to provide background services is a flat rate of $1,250 for each investigative report. The initial term of the agreement with PSC Investigations LLC for Background Investigative Services will be for a period of two (2) years effective June 1, 2023, with renewal options for up to three (3) successive one-year periods upon mutual agreement of both parties (potentially through May 31, 2028). DECISION-MAKER CONFLICT Staff has reviewed the decision contemplated by this action and has determined that it is not site-specific and consequently, the 500-foot rule found in California Code of Regulations Title 2, section 18702.2(a)(11), is not applicable to this decision for purposes of determining a disqualifying real property-related financial conflict of interest under the Political Reform Act (Cal. Gov't Code § 87100, et seq.). Staff is not independently aware and has not been informed by any City Council member, of any other fact that may constitute a basis for a decision maker conflict of interest in this matter. Page 479 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 3 CURRENT-YEAR FISCAL IMPACT All costs related to background investigative services are included in the fiscal year 2023 appropriations for the Police Department, resulting in no additional appropriations in the current fiscal year. ONGOING FISCAL IMPACT Future budgets will reflect the costs of background investigative services. ATTACHMENTS Attachment 1: RFP # P19-2023 for Background Investigative Services Attachment 2: Agreement with PSC Investigations LLC to provide Background Investigative Services Staff Contact: Jonathan Alegre, Police Department Page 480 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. __________ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA ACCEPTING PROPOSALS AND AWARDING AN AGREEMENT TO PSC INVESTIGATIONS LLC TO PROVIDE BACKGROUND INVESTIGATIVE SERVICES WHEREAS, on March 10, 2023, the City issued a Request for Proposal (RFP) #P19- 2023 for firms to submit their qualifications to provide background investigative services for the Police Department; and WHEREAS, four firms responded to the City's RFP; and WHEREAS, following a comprehensive review of the proposals submitted in response to the RFP, staff recommends awarding a contract to PSC Investigations LLC to provide background investigative services for the Police Department for an initial term of two (2) years. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista, that it accepts the proposals and awards a contract for services to PSC Investigations LLC to provide background investigative services for a period of two (2) years, with options to renew for up to three (3) additional one-year terms. BE IT FURTHER RESOLVED by the City Council of the City of Chula Vista, that it approves the Agreement for Background Investigative Services between the City and PSC Investigations LLC, in the form presented, as may have been modified by the Council prior to its approval and with such minor modifications as may be required or approved by the City Attorney, a copy of which shall be kept on file in the Office of the City Clerk, and authorizes and directs the Mayor to execute same. Presented by Approved as to form By: Roxana Kennedy Jill D.S. Maland Chief of Police Lounsbery Ferguson Altona & Peak Acting City Attorney Page 481 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭͮWĂŐĞ d,/dzK&,h>s/^d ZYh^d&KZWZKWK^> Z&WWϭϵͲϮϬϮϯ EŽƚŝĐĞŝƐŚĞƌĞďǇŐŝǀĞŶƚŚĂƚƉƌŽƉŽƐĂůƐǁŝůůďĞƌĞĐĞŝǀĞĚƵŶƚŝůϭϮ͗ϬϬW͘D͘ŽŶ&ƌŝĚĂǇ͕DĂƌĐŚϮϰ͕ϮϬϮϯ͕WĂĐŝĨŝĐ ^ƚĂŶĚĂƌĚdŝŵĞ;W^dͿ͕ĨƵƌŶŝƐŚŝŶŐƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂǁŝƚŚ͗ ĂĐŬŐƌŽƵŶĚ/ŶǀĞƐƚŝŐĂƚŝǀĞ^ĞƌǀŝĐĞƐ WƌŽƐƉĞĐƚŝǀĞWƌŽƉŽƐĞƌƐĂƌĞŚĞƌĞďǇƌĞĨĞƌƌĞĚƚŽƚŚĞƉƌŽƉŽƐĂůŝŶƐƚƌƵĐƚŝŽŶƐ͕ŐĞŶĞƌĂůƉƌŽǀŝƐŝŽŶƐ͕ĂŶĚƚĞƌŵƐĂŶĚ ĐŽŶĚŝƚŝŽŶƐĐŽŶƚĂŝŶĞĚŝŶƚŚŝƐƌĞƋƵĞƐƚĨŽƌƉƌŽƉŽƐĂů͘ůůƉƌŽƉŽƐĂůƐŵƵƐƚďĞƐƵďŵŝƚƚĞĚƚŚƌŽƵŐŚWůĂŶĞƚŝĚƐďǇ ƚŚĞĚƵĞĚĂƚĞĂŶĚƚŝŵĞ͘>ĂƚĞƉƌŽƉŽƐĂůƐǁŝůůŶŽƚďĞĐŽŶƐŝĚĞƌĞĚ͘ YƵĞƐƚŝŽŶƐƌĞůĂƚĞĚƚŽƚŚĞƉƌŽƉŽƐĂůŵƵƐƚďĞƐƵďŵŝƚƚĞĚƚŚƌŽƵŐŚWůĂŶĞƚŝĚƐ͘YƵĞƐƚŝŽŶƐŵƵƐƚďĞƌĞĐĞŝǀĞĚďǇ ϯ͗ϬϬW͘D͘dƵĞƐĚĂǇ͕DĂƌĐŚϭϰ͕ϮϬϮϯ͘ŶƐǁĞƌƐǁŝůůďĞƵƉůŽĂĚĞĚƚŽWůĂŶĞƚŝĚƐŶŽůĂƚĞƌƚŚĂŶϱ͗ϬϬW͘D͘ &ƌŝĚĂǇ͕DĂƌĐŚϭϳ͕ϮϬϮϯ͘ dŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƌĞũĞĐƚĂŶǇŽƌĂůůƉƌŽƉŽƐĂůƐƌĞĐĞŝǀĞĚĂŶǇƉŽƌƚŝŽŶŽĨĂŶǇƉƌŽƉŽƐĂůĂŶĚƚŽǁĂŝǀĞ ĂŶǇŝƌƌĞŐƵůĂƌŝƚŝĞƐŽƌŝŶĨŽƌŵĂůŝƚŝĞƐŝŶƉƌŽƉŽƐĂůƐŽƌƚŚĞZ&WƉƌŽĐĞƐƐ͘ŶǇĂĚĚĞŶĚĂƚŚĂƚĂƌĞŝƐƐƵĞĚƚŚƌŽƵŐŚ ƚŚŝƐZ&WŵƵƐƚďĞƐŝŐŶĞĚĂŶĚƌĞƚƵƌŶĞĚǁŝƚŚǇŽƵƌƐƵďŵŝƚƚĂů͘ sŝĐƚŽƌĞ>ĂƌƵǌ WƌŽĐƵƌĞŵĞŶƚ^ĞƌǀŝĐĞƐŶĂůǇƐƚ Page 482 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮͮWĂŐĞ ^ĐŚĞĚƵůĞ $FWLYLW\'DWH 5)33RVWHGWR3ODQHW%LGV 0DUFK 4XHVWLRQ6XEPLWWDOWKURXJK 3ODQHW%LGV 0DUFKQRODWHUWKDQ30 5HVSRQVHWR4XHVWLRQV5HOHDVHG 0DUFKQRODWHUWKDQ30 5)35HVSRQVHDQG3URSRVDO'XH 0DUFKQRODWHUWKDQSP 3UHVHQWDWLRQV,QWHUYLHZV $SULO 6HOHFWLRQRI&RQVXOWDQW $SULO &RXQFLO$GRSWLRQ $SULO &RQWUDFW,QFHSWLRQ 0D\ KďũĞĐƚŝǀĞ dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŝƐƐĞĞŬŝŶŐĐŽŵƉĞƚŝƚŝǀĞƉƌŽƉŽƐĂůƐĨƌŽŵĞǆƉĞƌŝĞŶĐĞĚĂŶĚƋƵĂůŝĨŝĞĚŝŶĚŝǀŝĚƵĂůƐ ŽƌĨŝƌŵƐƚŽƉƌŽǀŝĚĞƉƌŽĨĞƐƐŝŽŶĂůďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝǀĞƐĞƌǀŝĐĞƐ͘ dŚĞŽďũĞĐƚŝǀĞŽĨƚŚŝƐZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂů;Z&WͿŝƐƚŽĐŽŶƚƌĂĐƚĨŽƌĂŶŝŶŝƚŝĂůƚĞƌŵŽĨϯϴŵŽŶƚŚƐĨŽƌ ďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝǀĞƐĞƌǀŝĐĞƐ͘dŚĞŝƚǇǁŝůůĞǀĂůƵĂƚĞĂŶĚĚĞƚĞƌŵŝŶĞƚŚĞŶĞĞĚĨŽƌŽŶŐŽŝŶŐ ƐĞƌǀŝĐĞƐĂŶĚĂƚƚŚĞŝƚǇ͛ƐŽƉƚŝŽŶƚŚĞĂŐƌĞĞŵĞŶƚǁŝůůŝŶĐůƵĚĞƚǁŽ;ϮͿŽŶĞͲǇĞĂƌŽƉƚŝŽŶƐƚŽƌĞŶĞǁ͘ ĂĐŬŐƌŽƵŶĚ dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŝƐůŽĐĂƚĞĚŝŶƐŽƵƚŚĞƌŶ^ĂŶŝĞŐŽŽƵŶƚǇ͕ĂƉƉƌŽǆŝŵĂƚĞůǇƐĞǀĞŶŵŝůĞƐŶŽƌƚŚŽĨƚŚĞ ŝŶƚĞƌŶĂƚŝŽŶĂůďŽƌĚĞƌǁŝƚŚDĞǆŝĐŽ͘ŚƵůĂsŝƐƚĂŝƐƚŚĞƐĞĐŽŶĚůĂƌŐĞƐƚŝƚǇŝŶƚŚĞŽƵŶƚǇ͕ƚŚĞϭϱƚŚůĂƌŐĞƐƚŝŶ ĂůŝĨŽƌŶŝĂĂŶĚƚŚĞϳϱƚŚůĂƌŐĞƐƚŝƚǇŝŶƚŚĞhŶŝƚĞĚ^ƚĂƚĞƐ͘tŝƚŚĂƉŽƉƵůĂƚŝŽŶŽĨϮϲϴ͕ϬϬϬƌĞƐŝĚĞŶƚƐ͕ƚŚĞŝƚǇ ŽĨŚƵůĂsŝƐƚĂŝƐŽŶĞŽĨůĂƌŐĞƐƚĞŵƉůŽǇĞƌƐŝŶƚŚĞĐŽƵŶƚǇǁŝƚŚŽǀĞƌϭ͕ϰϬϬƌĞŐƵůĂƌĞŵƉůŽǇĞĞƐ͘ dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŝƐĂĨƵůůͲƐĞƌǀŝĐĞĐŚĂƌƚĞƌĐŝƚǇƉƌŽǀŝĚŝŶŐĂƌĂŶŐĞŽĨƐĞƌǀŝĐĞƐŝŶĐůƵĚŝŶŐƉŽůŝĐĞ͕ĨŝƌĞ͕ ĂŶŝŵĂůĐĂƌĞ͕ůŝďƌĂƌǇ͕ƉƵďůŝĐǁŽƌŬƐ͕ƉĂƌŬƐĂŶĚƌĞĐƌĞĂƚŝŽŶ͕ĚĞǀĞůŽƉŵĞŶƚƐĞƌǀŝĐĞƐ͕ĂŶĚĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ͘ dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂƐƚƌŝǀĞƐƚŽƉƌĞƐĞƌǀĞŝƚƐĨŝƐĐĂůŚĞĂůƚŚďǇƵƚŝůŝǌŝŶŐĐŽŶƚŝŶƵŽƵƐŝŵƉƌŽǀĞŵĞŶƚƚŽŽůƐĂŶĚ ďĞƐƚƉƌĂĐƚŝĐĞƐ͕ĞŶƐƵƌŝŶŐƐƚƌŽŶŐĂŶĚƐĞĐƵƌĞŶĞŝŐŚďŽƌŚŽŽĚƐƚŚŽƵŐŚŵĂǆŝŵŝǌŝŶŐƉŽůŝĐĞĂŶĚĨŝƌĞƐĞƌǀŝĐĞƐ͕ ŝŶĐƌĞĂƐŝŶŐůŽĐĂůůĂŶĚƵƐĞĐŽŶƚƌŽůƚŚƌŽƵŐŚƉŽůŝĐǇ͕ƉůĂŶŶŝŶŐ͕ŝŶĨƌĂƐƚƌƵĐƚƵƌĞĂŶĚƐĞƌǀŝĐĞƐƚŚĂƚĂƌĞ ĨƵŶĚĂŵĞŶƚĂůƚŽĂŶĞĐŽŶŽŵŝĐĂůůǇƐƚƌŽŶŐĐŝƚǇ͕ĂŶĚƐƵƉƉŽƌƚŝŶŐĂŶĞŶǀŝƌŽŶŵĞŶƚƚŚĂƚĨŽƐƚĞƌƐŚĞĂůƚŚĂŶĚ ǁĞůůŶĞƐƐĨŽƌŽƵƌƌĞƐŝĚĞŶƚƐ Page 483 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϯͮWĂŐĞ ^ĐŽƉĞŽĨtŽƌŬ;^KtͿ sĞŶĚŽƌƐŵƵƐƚďĞĂďůĞƚŽ͕ĂƚĂŵŝŶŝŵƵŵ͕ƉƌŽǀŝĚĞƚŚĞƐĞƌǀŝĐĞƐŽƵƚůŝŶĞĚďĞůŽǁ͘dŚĞƐƵĐĐĞƐƐĨƵůƌĞƐƉŽŶĚĞŶƚ ǁŝůůĂĚĚƌĞƐƐǇŽƵƌŽƌŐĂŶŝǌĂƚŝŽŶΖƐĂƉƉƌŽĂĐŚĂŶĚŵĞƚŚŽĚĨŽƌƐĂƚŝƐĨǇŝŶŐĞĂĐŚŽĨƚŚĞůŝƐƚĞĚŝƚĞŵƐ͘ůůƋƵŽƚĞĚ ĨĞĞƐƐŚŽƵůĚŝŶĐůƵĚĞƉƌŽǀŝĚŝŶŐƚŚĞƌĞƋƵĞƐƚĞĚƐĞƌǀŝĐĞƐŽƵƚůŝŶĞĚďĞůŽǁ͘ ϭ͘ĂĐŬŐƌŽƵŶĚ/ŶǀĞƐƚŝŐĂƚŽƌƐ;'/ƐͿŵƵƐƚďĞůŝĐĞŶƐĞĚWƌŝǀĂƚĞ/ŶǀĞƐƚŝŐĂƚŽƌƐŝŶƚŚĞ^ƚĂƚĞŽĨ ĂůŝĨŽƌŶŝĂ Ϯ͘'/ƐŵƵƐƚŚĂǀĞĐŽŵƉůĞƚĞĚĂĂůŝĨŽƌŶŝĂWĞĂĐĞKĨĨŝĐĞƌƐ^ƚĂŶĚĂƌĚƐĂŶĚdƌĂŝŶŝŶŐ;WK^dͿ ĐĞƌƚŝĨŝĞĚďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŽƌƐƐĐŚŽŽů ϯ͘ĂĐŬŐƌŽƵŶĚ ŝŶǀĞƐƚŝŐĂƚŝŽŶ ĂŶĚ ƌĞůĂƚĞĚ ƌĞƉŽƌƚƐ ŵƵƐƚ ĨŽůůŽǁ ƚŚĞ WK^d ĨŽƌŵĂƚ ǁŚĞŶ ĂƉƉůŝĐĂďůĞ ϰ͘'/ƐƐŚŽƵůĚŚĂǀĞƉƌŝŽƌůĂǁĞŶĨŽƌĐĞŵĞŶƚĞǆƉĞƌŝĞŶĐĞ;ƉƌĞĨĞƌƌĞĚͿ ϱ͘'/ƐŵƵƐƚŚĂǀĞĂĐĐĞƐƐĂŶĚĂďŝůŝƚǇƚŽƐƵďŵŝƚďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝǀĞƌĞƉŽƌƚƐĂŶĚƵƉĚĂƚĞƐ ǀŝĂsWĐŽŶƚƌĂĐƚĞĚĞ^KW,ďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝŽŶƐƐŽĨƚǁĂƌĞƉƌŽŐƌĂŵ ϲ͘ĂĐŬŐƌŽƵŶĚ ŝŶǀĞƐƚŝŐĂƚŝŽŶƐ ǁŝůů ďĞ ĐŽŵƉůĞƚĞĚ ǁŝƚŚŝŶ ϯϬͲĚĂǇƐ͕ ƵŶůĞƐƐ ŽƚŚĞƌǁŝƐĞ ƉƌĞĂƉƉƌŽǀĞĚďǇƚŚĞsWWƌŽĨĞƐƐŝŽŶĂů^ƚĂŶĚĂƌĚƐhŶŝƚ;W^hͿ ϳ͘ďŝůŝƚǇƚŽĐŽŵƉůĞƚĞĂŶĚƐƵďŵŝƚϱϬͲϭϬϬďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝǀĞƉĂĐŬĞƚƐĂŶŶƵĂůůǇ ϴ͘'/ƐŵƵƐƚďĞĂǀĂŝůĂďůĞƚŽƚƌĂǀĞůƚŽĐŽŶĚƵĐƚŽƵƚŽĨĐŽƵŶƚǇͬƐƚĂƚĞͬĐŽƵŶƚƌǇŝŶǀĞƐƚŝŐĂƚŝŽŶƐ ϵ͘'/ƐǁŝůůĂƐƐĞƐƐĂƉƉůŝĐĂŶƚĂŶĚĂŐĞŶĐǇƐƵďŵŝƚƚĞĚŵĂƚĞƌŝĂůƐ ϭϬ͘'/ƐǁŝůůĞŶƐƵƌĞƌĞĨĞƌĞŶĐĞƋƵĞƐƚŝŽŶŶĂŝƌĞƐĂƌĞƐĞŶƚǁŚĞŶĂƉƉůŝĐĂďůĞ ϭϭ͘'/ƐǁŝůůĐŽŶĚƵĐƚĂƉƉůŝĐĂŶƚŚŽŵĞǀŝƐŝƚƐ ϭϮ͘'/ƐǁŝůůĐŽŶĚƵĐƚŶĞŝŐŚďŽƌŚŽŽĚͬŶĞŝŐŚďŽƌĐŚĞĐŬƐĨŽƌĐƵƌƌĞŶƚĂŶĚƉĂƐƚƌĞƐŝĚĞŶĐĞƐ ϭϯ͘'/ƐǁŝůůĐŽŶĚƵĐƚĞŵƉůŽǇĞƌǀŝƐŝƚƐͬƉĞƌƐŽŶŶĞůĨŝůĞƌĞǀŝĞǁƐĨŽƌĐƵƌƌĞŶƚĂŶĚƉĂƐƚĞŵƉůŽǇŵĞŶƚ ϭϰ͘'/Ɛ ǁŝůů ƐĞŶĚ ŽƵƚ ĐƌŝŵŝŶĂů ŚŝƐƚŽƌǇ ĐŚĞĐŬƐ ƚŽ ůĂǁ ĞŶĨŽƌĐĞŵĞŶƚ ;>Ϳ ĂŐĞŶĐŝĞƐ ǁŝƚŚŝŶ ƌĞƐŝĚĞŶƚŝĂůũƵƌŝƐĚŝĐƚŝŽŶƐ ϭϱ͘'/ƐǁŝůůƌĞǀŝĞǁĂŶĚĐŽŵƉŝůĞƌĞĨĞƌĞŶĐĞƋƵĞƐƚŝŽŶŶĂŝƌĞƐ ϭϲ͘'/ƐǁŝůůŝŶƚĞƌǀŝĞǁƐĞůĞĐƚĞĚƌĞĨĞƌĞŶĐĞƐ͕ŽĨƚĞŶŝŶƉĞƌƐŽŶǁŚĞŶŶĞĐĞƐƐĂƌǇ ϭϳ͘'/ƐǁŝůůĐŽŶĨŝƌŵĂŶĚƌĞǀŝĞǁŽƚŚĞƌ>ĂŐĞŶĐǇĐĂŶĚŝĚĂƚĞĂƉƉůŝĐĂƚŝŽŶƐ ĂŶĚ ƌĞǀŝĞǁ ĚŝƐƉŽƐŝƚŝŽŶ ϭϴ͘'/ƐǁŝůůĐŽŵƉůĞƚĞŝŶǀĞƐƚŝŐĂƚŝǀĞŶĂƌƌĂƚŝǀĞƐƵƐŝŶŐWK^dĨŽƌŵĂƚŽƌŐĞŶĐǇƉƌĞĨĞƌƌĞĚĨŽƌŵĂƚ ϭϵ͘/ŶǀĞƐƚŝŐĂƚŝǀĞƉĂĐŬĂŐĞƐƌĞǀŝĞǁĞĚďǇŝŶǀĞƐƚŝŐĂƚŝŶŐĐŽŵƉĂŶǇŵĂŶĂŐĞŵĞŶƚ ϮϬ͘'/ƐǁŝůůƐƵďŵŝƚŝŶǀĞƐƚŝŐĂƚŝǀĞƉĂĐŬĂŐĞƐƚŽW^h Ϯϭ͘ǆƉĞĚŝƚĞĚďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝŽŶʹďŝůŝƚǇƚŽĐŽŵƉůĞƚĞĂďĂĐŬŐƌŽƵŶĚŝŶǀĞƐƚŝŐĂƚŝŽŶ ǁŝƚŚŝŶƚǁŽ;ϮͿǁĞĞŬƐ͘ Page 484 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϰͮWĂŐĞ WƌŽƉŽƐĂů&ŽƌŵĂŶĚŽŶƚĞŶƚ dŚĞŝƚǇǁŝůůĂĐĐĞƉƚƉƌŽƉŽƐĂůƐŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞŝŶƐƚƌƵĐƚŝŽŶƐĂŶĚƐƉĞĐŝĨŝĐĂƚŝŽŶƐŝŶƚŚŝƐZĞƋƵĞƐƚĨŽƌ WƌŽƉŽƐĂů;Z&WͿ͘ ͘WƌŽǀŝĚĞŽŶĞ;ϭͿŽƌŝŐŝŶĂůW&ĚŽĐƵŵĞŶƚƵƉůŽĂĚĞĚŝŶWůĂŶĞƚŝĚƐŽŶŽƌďĞĨŽƌĞƚŚĞĚĂƚĞŝĚĞŶƚŝĨŝĞĚŝŶ ƚŚŝƐZ&W͘ ͘WZWZd/KE͗WƌŽƉŽƐĂůƐƐŚŽƵůĚďĞƉƌĞƉĂƌĞĚŝŶƐƵĐŚĂǁĂǇĂƐƚŽƉƌŽǀŝĚĞĂƐƚƌĂŝŐŚƚĨŽƌǁĂƌĚ͕ ĐŽŶĐŝƐĞĚĞůŝŶĞĂƚŝŽŶŽĨĐĂƉĂďŝůŝƚŝĞƐƚŽƐĂƚŝƐĨǇƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚŝƐZ&WĂŶĚƐŚŽƵůĚĂĚĚƌĞƐƐŚŽǁ ǇŽƵƌĨŝƌŵǁŽƵůĚƉƌŽǀŝĚĞƚŚĞƐĞƌǀŝĐĞƐŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ^ĐŽƉĞŽĨtŽƌŬ͘ ͘WZKWK^>&KZDd͗WƌŽƉŽƐĂůƐƐŚĂůůĂĚŚĞƌĞƚŽƚŚĞĨŽůůŽǁŝŶŐĨŽƌŵĂƚĨŽƌŽƌŐĂŶŝǌĂƚŝŽŶĂŶĚĐŽŶƚĞŶƚ͘ WƌŽƉŽƐĂůƐŵƵƐƚďĞĚŝǀŝĚĞĚŝŶƚŽƚŚĞŝŶĚŝǀŝĚƵĂůƐĞĐƚŝŽŶƐůŝƐƚĞĚďĞůŽǁ͘ ͘'EZ>/E&KZDd/KEEyW/ZE͗WƌŽǀŝĚĞĂďƌŝĞĨĚĞƐĐƌŝƉƚŝŽŶŽĨǇŽƵƌŽƌŐĂŶŝǌĂƚŝŽŶĂů ƐƚƌƵĐƚƵƌĞ͕ŝŶĐůƵĚŝŶŐŝĨĂŶǇƐŝŐŶŝĨŝĐĂŶƚĐŚĂŶŐĞƐƚŽƐƚƌƵĐƚƵƌĞŽƌůĞĂĚĞƌƐŚŝƉŝŶƚŚĞƉĂƐƚϯϲŵŽŶƚŚƐ͕ ĂŶĚĂŶǇĞǆƉĞĐƚĞĚŽƌŐĂŶŝǌĂƚŝŽŶĂůĐŚĂŶŐĞƐŝŶƚŚĞŶĞǆƚǇĞĂƌ͘/ĚĞŶƚŝĨǇ ƚŚĞŶƵŵďĞƌŽĨǇĞĂƌƐ ŽĨ ĞǆƉĞƌŝĞŶĐĞ ŝŶ ƉƌŽǀŝĚŝŶŐ ďĂĐŬŐƌŽƵŶĚ ŝŶǀĞƐƚŝŐĂƚŝǀĞ ƐĞƌǀŝĐĞƐ͕ ƐŝŵŝůĂƌ ŝŶ ƐŝǌĞ ĂŶĚ ƐĐŽƉĞ ƚŽ ƚŚĂƚ ƌĞƋƵĞƐƚĞĚŝŶƚŚĞZ&W͘ ͘W/>/d/^͗dŚŝƐƌĞůĂƚĞƐƚŽƚŚĞŝŶĚŝǀŝĚƵĂůͬĨŝƌŵ͛ƐĐĂƉĂďŝůŝƚŝĞƐƚŽƉƌŽǀŝĚĞƚŚĞƉƌŽĨĞƐƐŝŽŶĂůƐĞƌǀŝĐĞƐ ĚĞƐĐƌŝďĞĚŝŶƚŚĞ^ĐŽƉĞŽĨ^ĞƌǀŝĐĞƐ͘WůĞĂƐĞĚĞŵŽŶƐƚƌĂƚĞƚŚĞŝŶĚŝǀŝĚƵĂůͬĨŝƌŵ͛ƐĐĂƉĂďŝůŝƚŝĞƐ͕ƵƐŝŶŐ ƐƉĞĐŝĨŝĐŝŶǀĞƐƚŝŐĂƚŝǀĞƐŽůƵƚŝŽŶƐ͕ƚŚĞŝŶĚŝǀŝĚƵĂůͬĨŝƌŵ͛ƐƌŽůĞŝŶƚŚĞƉƌŽĐĞƐƐ͕ĂŶĚŬĞǇƉŽŝŶƚƐŽĨĐŽŶƚĂĐƚ ůŽďďŝĞĚĂŶĚͬŽƌĐŽŽƌĚŝŶĂƚĞĚǁŝƚŚƚŽĂĐŚŝĞǀĞĂƐƵĐĐĞƐƐĨƵůŽƵƚĐŽŵĞ͘ WƌŽǀŝĚĞ ĨŝǀĞ ;ϱͿ ĐůŝĞŶƚ ƌĞĨĞƌĞŶĐĞƐĨŽƌǁŚŝĐŚǇŽƵƌ&ŝƌŵŚĂƐƉƌŽǀŝĚĞĚƐŝŵŝůĂƌƐĞƌǀŝĐĞƐ͘ZĞĨĞƌĞŶĐĞƐƐŚĂůůŝŶĐůƵĚĞĚĂƚĞĂŶĚ ĚĞƐĐƌŝƉƚŝŽŶŽĨƐĞƌǀŝĐĞ͕ƉƌŽũĞĐƚůŽĐĂƚŝŽŶ͕ĐŽŵƉůĞƚŝŽŶĚĂƚĞƐ͕ŽƌŐĂŶŝǌĂƚŝŽŶ͛ƐŶĂŵĞ͕ĐŽŶƚĂĐƚƉĞƌƐŽŶ͕ ƚŝƚůĞ͕ĂĚĚƌĞƐƐ͕ĂŶĚƚĞůĞƉŚŽŶĞŶƵŵďĞƌ͘ &͘WK/EdK&KEdd͗/ĚĞŶƚŝĨǇƚŚĞƉƌŝŵĂƌǇĐŽŶƚĂĐƚĨŽƌƚŚĞŝƚǇĂŶĚŽƚŚĞƌƐƵďĐŽŶƐƵůƚĂŶƚƐƚŚĂƚŵĂǇ ďĞƉƌŽƉŽƐĞĚƚŽďĞƵƐĞĚ͘ĂĐŬŐƌŽƵŶĚƐŽƌďŝŽŐƌĂƉŚŝĞƐƐŚŽƵůĚďĞƉƌŽǀŝĚĞĚĂůŽŶŐǁŝƚŚĐŽƉŝĞƐŽĨĂůů ŝŶǀĞƐƚŝŐĂƚŽƌůŝĐĞŶƐĞƐĂŶĚƚŚĞŝƌWK^dĐĞƌƚŝĨŝĐĂƚĞƐƐŚŽǁŝŶŐƚŚĞĐŽŵƉůĞƚŝŽŶŽĨƚŚĞŝŶǀĞƐƚŝŐĂƚŽƌƐ ĐŽƵƌƐĞ͘ '͘&/ZD͛^Dd,KK>K'zEWWZK,dKtKZ<͗dŚŝƐƐŚŽƵůĚŝŶĐůƵĚĞĂĚĞƐĐƌŝƉƚŝŽŶŽĨǇŽƵƌ ƉƌŽƉŽƐĞĚǁŽƌŬŝŶŐĐŽŶĚŝƚŝŽŶƐ͕ĂƐƐƵŵƉƚŝŽŶƐĂŶĚŵĞƚŚŽĚŽůŽŐǇƚŽƉƌŽǀŝĚĞƚŚĞƌĞƋƵĞƐƚĞĚƐĞƌǀŝĐĞƐ ƚŚĂƚǁĞƌĞƵƐĞĚƚŽĚĞǀĞůŽƉƚŚĞĨĞĞƉƌŽƉŽƐĂů͘ ,͘&/ZD͛^ W,/>K^KW,z E d,/> ^dEZ^͗ WƌŽǀŝĚĞ Ă ĚĞƚĂŝůĞĚ ĚĞƐĐƌŝƉƚŝŽŶ ŽĨƚŚĞ Ĩŝƌŵ͛Ɛ ƉŚŝůŽƐŽƉŚǇĂŶĚĞƚŚŝĐĂůƐƚĂŶĚĂƌĚƐ͘ /͘&WZKWK^>͗dŚĞƉƌŽƉŽƐĂůƐŚĂůůŝŶĐůƵĚĞĨĞĞƐĨŽƌĂůůƐĞƌǀŝĐĞƐƚŽďĞƉƌŽǀŝĚĞĚ͘/ĚĞŶƚŝĨǇĂŶǇ ĂĚĚŝƚŝŽŶĂůĐŽƐƚƐƌĞůĂƚĞĚƚŽĂŶǆƉĞĚŝƚĞĚĂĐŬŐƌŽƵŶĚ/ŶǀĞƐƚŝŐĂƚŝŽŶ͘ :͘d>K&KEdEd^ͲdŚĞƚĂďůĞŽĨĐŽŶƚĞŶƚƐƐŚĂůůŝĚĞŶƚŝĨǇƚŚĞĐŽŶƚĞŶƚƐŽĨƚŚĞƉƌŽƉŽƐĂůŝŶĂĨŽƌŵĂƚ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƉƌŽƉŽƐĂůƌĞƋƵŝƌĞŵĞŶƚƐĂŶĚĨŽƌŵĂƚƐĞƚĨŽƌƚŚŚĞƌĞŝŶ͘ Page 485 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϱͮWĂŐĞ ǀĂůƵĂƚŝŽŶDĞƚŚŽĚ ůůƉƌŽƉŽƐĂůƐƐŚĂůůďĞƌĞǀŝĞǁĞĚƚŽǀĞƌŝĨǇƚŚĂƚƚŚĞZĞƐƉŽŶĚĞŶƚŚĂƐŵĞƚƚŚĞŵŝŶŝŵƵŵƌĞƋƵŝƌĞŵĞŶƚƐ͘ WƌŽƉŽƐĂůƐ ƚŚĂƚ ŚĂǀĞ ŶŽƚ ĐŽŵƉůŝĞĚ ǁŝƚŚ ƌĞƋƵŝƌĞŵĞŶƚƐ͕ ĚŽ ŶŽƚ ŵĞĞƚ ŵŝŶŝŵƵŵ ĐŽŶƚĞŶƚ ĂŶĚ ƋƵĂůŝƚǇ ƐƚĂŶĚĂƌĚƐ͕ŽƌƚĂŬĞƵŶĂĐĐĞƉƚĂďůĞĞǆĐĞƉƚŝŽŶƐƚŽƚŚĞ'ĞŶĞƌĂůdĞƌŵƐĂŶĚŽŶĚŝƚŝŽŶƐŽƌϮͲƉĂƌƚǇĂŐƌĞĞŵĞŶƚ͕ ǁŝůůďĞĞůŝŵŝŶĂƚĞĚĨƌŽŵĨƵƌƚŚĞƌĐŽŶƐŝĚĞƌĂƚŝŽŶ͘WƌŽƉŽƐĂůƐǁŝůůďĞƌĞǀŝĞǁĞĚĂŶĚĞǀĂůƵĂƚĞĚďǇĂŶĞǀĂůƵĂƚŝŽŶ ĐŽŵŵŝƚƚĞĞĐŽŵƉƌŝƐĞĚŽĨŝƚǇŽĨŚƵůĂsŝƐƚĂƉĞƌƐŽŶŶĞů͘dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŝŶƚĞŶĚƐƚŽĂĐĐĞƉƚƚŚĞ ƉƌŽƉŽƐĂůŝƚĚĞƚĞƌŵŝŶĞƐƚŽďĞŝŶƚŚĞďĞƐƚŝŶƚĞƌĞƐƚƐŽĨƚŚĞŝƚǇ͕ďĂƐĞĚŽŶƚŚĞŽǀĞƌĂůůƉƌŽƉŽƐĂů͕ŶŽƚĞǆĐůƵƐŝǀĞůǇ ŽŶĐŽƐƚŽƌĂŶǇŽƚŚĞƌƐƉĞĐŝĨŝĐĨĂĐƚŽƌ͘dŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĂŵĞŶĚ͕ŵŽĚŝĨǇ͕ƌĞũĞĐƚ͕ŶĞŐŽƚŝĂƚĞ͕Žƌ ĂĐĐĞƉƚĂŶǇƉƌŽƉŽƐĂůŝŶǁŚŽůĞŽƌŝŶƉĂƌƚĂƚŝƚƐƐŽůĞĚŝƐĐƌĞƚŝŽŶ͘ ǀĂůƵĂƚŝŽŶƌŝƚĞƌŝĂ dŚĞĂǁĂƌĚƚŽƚŚĞƐƵĐĐĞƐƐĨƵůZĞƐƉŽŶĚĞŶƚǁŝůůďĞďĂƐĞĚƵƉŽŶƌĞƐƉŽŶƐĞƚŽƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽƵƚůŝŶĞĚŝŶƚŚŝƐ Z&W͕ĂŶĚĂŶĞƐƚŝŵĂƚĞŽĨƚŚĞƋƵĂůŝƚǇĂŶĚĞĨĨĞĐƚŝǀĞŶĞƐƐŽĨĞĂĐŚŝƚ͛ƐƐĞƌǀŝĐĞƐŝŶƚŚĞĨŽůůŽǁŝŶŐĂƌĞĂƐ;ŶŽƚůŝƐƚĞĚ ŝŶŽƌĚĞƌŽĨŝŵƉŽƌƚĂŶĐĞͿ͗ Ă͘ǆƉĞƌŝĞŶĐĞͬWĂƐƚWĞƌĨŽƌŵĂŶĐĞͬZĞĨĞƌĞŶĐĞƐ;DƵƐƚŚĂǀĞĂŵŝŶŝŵƵŵŽĨϱǇĞĂƌƐƉƵďůŝĐƐĞĐƚŽƌ ĞǆƉĞƌŝĞŶĐĞǁŝƚŚĂŝƚǇŽƌŽƵŶƚǇŐĞŶĐǇͿʹŽŶƐŝĚĞƌĂƚŝŽŶǁŝůůďĞŐŝǀĞŶďĂƐĞĚƵƉŽŶƚŚĞ Ĩŝƌŵ͛Ɛ ĞǆƉĞƌŝĞŶĐĞ͕ ǇĞĂƌƐ ŝŶ ďƵƐŝŶĞƐƐ͕ ƉĂƐƚ ĂŶĚ ĐƵƌƌĞŶƚ ĐůŝĞŶƚ ƌĞĨĞƌĞŶĐĞƐ͖ ƚĞĐŚŶŝĐĂů ĞǆƉĞƌƚŝƐĞĂŶĚƉƌŽĨĞƐƐŝŽŶĂůĐŽŵƉĞƚĞŶĐĞŝŶĂƌĞĂƐĚŝƌĞĐƚůǇƌĞůĂƚĞĚƚŽƚŚŝƐZ&W͖ŶƵŵďĞƌŽĨ ǇĞĂƌƐ͛ĞǆƉĞƌŝĞŶĐĞŝŶƉĞƌĨŽƌŵŝŶŐƐŝŵŝůĂƌǁŽƌŬŝŶƉĞƌĨŽƌŵŝŶŐŝŶǀĞƐƚŝŐĂƚŝǀĞƐĞƌǀŝĐĞƐĨŽƌ ŵƵŶŝĐŝƉĂůŝƚŝĞƐŝŶĂůŝĨŽƌŶŝĂ͘ ď͘WĞƌƐŽŶŶĞůʹZĞƐƉŽŶĚĞŶƚƐŚĂůůƐƵďŵŝƚƌĞƐƵŵĞƐŽĨĂůůƉƌŝŵĂƌǇƉƌŽĨĞƐƐŝŽŶĂůƐƚĂĨĨŵĞŵďĞƌƐ ǁŚŽǁŝůůďĞƉĞƌĨŽƌŵŝŶŐƐĞƌǀŝĐĞƐƵŶĚĞƌƚŚĞĐŽŶƚƌĂĐƚ͘ZĞƐƉŽŶĚĞŶƚƐŚŽƵůĚĚĞŵŽŶƐƚƌĂƚĞƚŚĂƚ ĂůůŬĞǇƉĞƌƐŽŶŶĞůŚĂǀĞďĞĞŶƐƵĐĐĞƐƐĨƵůůǇŝŶǀŽůǀĞĚǁŝƚŚƉƌŽũĞĐƚƐŽĨƐŝŵŝůĂƌƐĐŽƉĞĂŶĚ ŵĂŐŶŝƚƵĚĞ͘ Đ͘YƵĂůŝĨŝĐĂƚŝŽŶƐʹdŚŝƐĐĂƚĞŐŽƌǇǁŝůůĞǀĂůƵĂƚĞƚŚĞZĞƐƉŽŶĚĞŶƚ͛ƐĂďŝůŝƚǇƚŽƚĂŬĞƵƉŽŶŝƚƐĞůĨƚŚĞ ƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐƐĞƚĨŽƌƚŚŝŶƚŚĞ^ĐŽƉĞŽĨtŽƌŬĂŶĚƉƌŽĚƵĐĞƚŚĞƌĞƋƵŝƌĞĚŽƵƚĐŽŵĞŝŶĂ ƚŝŵĞůǇ ŵĂŶŶĞƌ͘ ŽŶƐŝĚĞƌĂƚŝŽŶ ǁŝůů ďĞ ŐŝǀĞŶ ĨŽƌ ƚŚĞ ŽǀĞƌĂůů ƋƵĂůŝƚǇ ŽĨ ƚŚĞ ƉƌŽƉŽƐĂů͕ ŝŶĐůƵĚŝŶŐĂĚĞŵŽŶƐƚƌĂƚĞĚƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨƚŚĞƉƵƌƉŽƐĞ͕ƐĐŽƉĞĂŶĚŽďũĞĐƚŝǀĞŽĨƚŚĞ ƐĞƌǀŝĐĞƐƚŽďĞƉĞƌĨŽƌŵĞĚ͘/ƚŝƐƚŚĞŝŶƚĞŶƚŝŽŶŽĨƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂƚŽĂǁĂƌĚĂĐŽŶƚƌĂĐƚ ƚŽƚŚĞZĞƐƉŽŶĚĞŶƚǁŚŽĨƵƌŶŝƐŚĞƐƐĂƚŝƐĨĂĐƚŽƌǇĞǀŝĚĞŶĐĞƚŚĂƚƚŚĞZĞƐƉŽŶĚĞŶƚŚĂƐƚŚĞ ƌĞƋƵŝƐŝƚĞ ĞǆƉĞƌŝĞŶĐĞ ĂŶĚ ĂďŝůŝƚǇƚŽ ĞŶĂďůĞ ƚŚĞ ZĞƐƉŽŶĚĞŶƚ ƚŽ ƉƌŽƐĞĐƵƚĞ ƚŚĞ ǁŽƌŬ ƐƵĐĐĞƐƐĨƵůůǇĂŶĚƉƌŽƉĞƌůǇ͕ĂŶĚƚŽĐŽŵƉůĞƚĞƐĞƌǀŝĐĞƐŝŶĂƚŝŵĞůǇŵĂŶŶĞƌ͘dŽĚĞƚĞƌŵŝŶĞƚŚĞ ĚĞŐƌĞĞŽĨƌĞƐƉŽŶƐŝďŝůŝƚǇƚŽďĞĐƌĞĚŝƚĞĚƚŽƚŚĞZĞƐƉŽŶĚĞŶƚ͕ƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂǁŝůů ǁĞŝŐŚƚŚĞĞǀŝĚĞŶĐĞƚŚĂƚƚŚĞZĞƐƉŽŶĚĞŶƚŚĂƐƉĞƌĨŽƌŵĞĚƐĂƚŝƐĨĂĐƚŽƌŝůǇŽƚŚĞƌĐŽŶƚƌĂĐƚƐŽĨ ůŝŬĞŶĂƚƵƌĞ͕ŵĂŐŶŝƚƵĚĞĂŶĚĐŽŵƉĂƌĂďůĞĚŝĨĨŝĐƵůƚǇĂŶĚĐŽŵƉĂƌĂďůĞƌĂƚĞƐŽĨƉƌŽŐƌĞƐƐ͘ Ě͘WƌŽƉŽƐĞĚŽƐƚ Ğ͘KƉƚŝŽŶĂů /ŶƚĞƌǀŝĞǁ ʹ /Ŷ ƚŚĞ ĞǀĞŶƚ ƚŚĞ ŝƚǇ ĚĞĐŝĚĞƐ ƚŚĂƚ ŝŶƚĞƌǀŝĞǁƐ ĂƌĞ ŶĞĐĞƐƐĂƌǇ͕ ZĞƐƉŽŶĚĞŶƚƐǁŚŽĂƌĞĨŝŶĂůŝƐƚƐǁŝůůďĞŶŽƚŝĨŝĞĚĂƐƉƌŽŵƉƚůǇĂƐƉŽƐƐŝďůĞ͘ĂĐŚŝŶƚĞƌǀŝĞǁǁŝůů ĐŽŶƐŝƐƚŽĨĂƉƌĞƐĞŶƚĂƚŝŽŶŽĨŶŽůŽŶŐĞƌƚŚĂŶŽŶĞ;ϭͿŚŽƵƌ͘EŽƚŝĐĞŽĨĐŽŶĨŝƌŵĂƚŝŽŶŽĨƚŚĞ ŝŶƚĞƌǀŝĞǁĚĂƚĞͬƚŝŵĞǁŝůůďĞŐŝǀĞŶďǇƚĞůĞƉŚŽŶĞŽƌŝŶǁƌŝƚŝŶŐ͘ Page 486 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϲͮWĂŐĞ 'EZ>KE/d/KE^ ǀĂůƵĂƚŝŽŶ dŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚĂůŽŶŐǁŝƚŚƚŚĞĞƉĂƌƚŵĞŶƚZĞƉƌĞƐĞŶƚĂƚŝǀĞƐǁŝůůĞǀĂůƵĂƚĞƌĞƐƉŽŶƐĞƐ͘dŚĞ ŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƌĞũĞĐƚ ĂŶǇŽƌĂůůƌĞƐƉŽŶƐĞƐĂŶĚƚŽǁĂŝǀĞĂŶǇŝƌƌĞŐƵůĂƌŝƚǇŽƌŝŶĨŽƌŵĂůŝƚǇŝŶĂŶǇƌĞƐƉŽŶƐĞƚŽƚŚĞĞǆƚĞŶƚƉĞƌŵŝƚƚĞĚďǇůĂǁ͘ ůůƌĞƐƉŽŶĚĞŶƚƐĂƌĞ ƌĞƐƉŽŶƐŝďůĞ ĨŽƌƌĞĂĚŝŶŐƚŚĞĂƚƚĂĐŚĞĚ ƐƉĞĐŝĨŝĐĂƚŝŽŶƐ͕ƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐ͕WĞƌĨŽƌŵĂŶĐĞ^ƚĂŶĚĂƌĚƐ͕'ĞŶĞƌĂůŽŶĚŝƚŝŽŶƐ͕ĂŶĚ 'ĞŶĞƌĂůWƌŽǀŝƐŝŽŶƐ͕ǁŚŝĐŚĂƌĞĐŽŶƐŝĚĞƌĞĚƉĂƌƚŽĨǇŽƵƌďŝĚĂŶĚĂŶǇĐŽŶƚƌĂĐƚĂǁĂƌĚĞĚ͘ ǁĂƌĚ /ƚŝƐƚŚĞŝƚǇ͛ƐŝŶƚĞŶƚƚŽĂǁĂƌĚƚŚŝƐĐŽŶƚƌĂĐƚƚŽĂƐŝŶŐůĞĐŽŶƚƌĂĐƚŽƌďĂƐĞĚŽŶƚŚĞƉƌŝŵĂƌǇƐĞƌǀŝĐĞƐ;ĂƐŽƵƚůŝŶĞĚŽŶWůĂŶĞƚŝĚƐͿ͘ ,ŽǁĞǀĞƌ͕ƚŚĞĐŝƚǇƌĞƚĂŝŶƐƚŚĞĂďŝůŝƚǇƚŽƵƚŝůŝǌĞĂůƚĞƌŶĂƚĞĐŽŶƚƌĂĐƚŽƌͬƐŝŶƚŚĞĞǀĞŶƚƚŚĞĂǁĂƌĚĞĚĐŽŶƚƌĂĐƚŽƌŝƐƵŶĂďůĞƚŽƉƌŽǀŝĚĞ ƐĞƌǀŝĐĞƐŝŶƚŚĞƚŝŵĞŽƵƚůŝŶĞĚďǇƚŚĞĐŝƚǇ͘dŚĞĂǁĂƌĚǁŝůůďĞ ŵĂĚĞ ƚŽ ƚŚĞ ůŽǁĞƐƚ͕ ƌĞƐƉŽŶƐŝǀĞĂŶĚ ƌĞƐƉŽŶƐŝďůĞďŝĚĚĞƌǁŚŽ͕ ŝŶ ƚŚĞŝƚǇΖƐ ƐŽůĞũƵĚŐĞŵĞŶƚ͕ŚĂƐƚŚĞŶĞĐĞƐƐĂƌǇĞǆƉĞƌŝĞŶĐĞ͕ƐŬŝůů͕ďƵƐŝŶĞƐƐƐƚĂŶĚŝŶŐ͕ĞƋƵŝƉŵĞŶƚ͕ƐƚĂĨĨŝŶŐ͕ĂŶĚĨŝŶĂŶĐŝĂůƐƚĂďŝůŝƚǇ ƚŽ ƉƌŽƉĞƌůǇ ŵĂŝŶƚĂŝŶ ƚŚĞ ŝƚǇΖƐďŝĚ͘ dŚĞĞǆƚĞŶƚƚŽǁŚŝĐŚ ƚŚĞƌĞƐƉŽŶĚĞŶƚ ƉƌŽƉŽƐĞƐ ƚŽƐƵďĐŽŶƚƌĂĐƚǁŽƌŬ ǁŝůů ĂůƐŽ ďĞ Ă ĐŽŶƐŝĚĞƌĂƚŝŽŶŝŶĂǁĂƌĚ͘ dŚŝƐZ&ĚŽĞƐŶŽƚĐŽŵŵŝƚƚŚĞŝƚǇƚŽĂǁĂƌĚĂĐŽŶƚƌĂĐƚ͕ƚŽƉĂǇĂŶǇĐŽƐƚƐŝŶĐƵƌƌĞĚ ŝŶƚŚĞƉƌĞƉĂƌĂƚŝŽŶŽĨƚŚĞƉƌŽƉŽƐĂů ƚŽƚŚŝƐ ƌĞƋƵĞƐƚ͕ŽƌƚŽƉƌŽĐƵƌĞ ŽƌĐŽŶƚƌĂĐƚĨŽƌƐĞƌǀŝĐĞƐŽƌƐƵƉƉůŝĞƐ͘dŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĂĐĐĞƉƚŽƌƌĞũĞĐƚĂŶǇŽƌĂůůƉƌŽƉŽƐĂůƐ ƌĞĐĞŝǀĞĚĂƐĂƌĞƐƵůƚŽĨƚŚŝƐƌĞƋƵĞƐƚ͕ƚŽŶĞŐŽƚŝĂƚĞǁŝƚŚĂŶǇƋƵĂůŝĨŝĞĚƐŽƵƌĐĞ͕ŽƌƚŽĐĂŶĐĞůŝŶƉĂƌƚŽƌĞŶƚŝƌĞůǇƚŚŝƐZ&͕ŝĨŝƚŝƐŝŶƚŚĞ ďĞƐƚŝŶƚĞƌĞƐƚŽĨƚŚĞŝƚǇƚŽĚŽƐŽ͘dŚĞŝƚǇĨƵƌƚŚĞƌƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽǁĂŝǀĞĂŶǇƚĞĐŚŶŝĐĂůŝƚŝĞƐŽƌŵŝŶŽƌŝƌƌĞŐƵůĂƌŝƚŝĞƐŝŶďŝĚƐ ƌĞĐĞŝǀĞĚ͘dŚĞŝƚǇŵĂǇƌĞƋƵŝƌĞƚŚĞƐĞůĞĐƚĞĚƌĞƐƉŽŶĚĞŶƚƚŽƉĂƌƚŝĐŝƉĂƚĞŝŶŶĞŐŽƚŝĂƚŝŽŶƐ ĂŶĚƚŽƐƵďŵŝƚƐƵĐŚƉƌŝĐĞ͕ƚĞĐŚŶŝĐĂů Žƌ ŽƚŚĞƌƌĞǀŝƐŝŽŶƐŽĨƚŚĞŝƌƉƌŽƉŽƐĂůƐĂƐŵĂǇƌĞƐƵůƚĨƌŽŵŶĞŐŽƚŝĂƚŝŽŶƐ͘dŚĞŝƚǇƐŚĂůůďĞƚŚĞƐŽůĞũƵĚŐĞ ŝŶĚĞƚĞƌŵŝŶŝŶŐ ĂǁĂƌĚŽĨ ĐŽŶƚƌĂĐƚ͘ >ŽĐĂůƵƐŝŶĞƐƐŽŶƐŝĚĞƌĂƚŝŽŶ ĐĐŽƌĚŝŶŐƚŽ ƚŚĞŚƵůĂ sŝƐƚĂ DƵŶŝĐŝƉĂůŽĚĞ͕ ŚĂƉƚĞƌ Ϯ͘ϱϲ͘ϬϴϬ͕ůĞƚƚĞƌ '͕ /ŶĂĐĐŽƌĚĂŶĐĞ ǁŝƚŚ^ĞĐƚŝŽŶϭϬϭϭŽĨƚŚĞŚĂƌƚĞƌ͕ ŝŶƚŚĞĞǀĞŶƚƚǁŽŽƌŵŽƌĞďŝĚƐĂƌĞƌĞĐĞŝǀĞĚǁŚŝĐŚĂƌĞĨŽƌƚŚĞƐĂŵĞƚŽƚĂůĂŵŽƵŶƚŽƌƵŶŝƚƉƌŝĐĞ ĂŶĚŝŶĂůůŽƚŚĞƌƌĞƐƉĞĐƚƐ ĂƌĞ ĞƋƵĂů͕ƚŚĞĐŽŶƚƌĂĐƚ ƐŚĂůůďĞĂǁĂƌĚĞĚƚŽĂůŽĐĂůƌĞƐƉŽŶĚĞŶƚ͘/ŶƚŚĞĞǀĞŶƚ͕ŚŽǁĞǀĞƌ͕ ƚŚĂƚƐƵĐŚƚŝĞďŝĚƐĂƌĞĂůůĨƌŽŵǀĞŶĚŽƌƐ ĞŝƚŚĞƌ ǁŚŽůůǇ ŝŶƐŝĚĞ Žƌ ĂůůŽƵƚƐŝĚĞ ŽĨƚŚĞĐŝƚǇ͕ƚŚĞŶƚŚĞĐŽŶƚƌĂĐƚ ƐŚĂůůďĞĂǁĂƌĚĞĚďǇ ĚƌĂǁŝŶŐůŽƚƐŝŶƉƵďůŝĐ͘ /ŶĞǀĂůƵĂƚŝŶŐ ďŝĚƐĨŽƌĂǁĂƌĚ͕ƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂĐŽŶƐŝĚĞƌƐƚŚĞϭйƐĂůĞƐƚĂǆĂůůŽĐĂƚĞĚďĂĐŬƚŽƚŚĞŝƚǇĨƌŽŵǀĞŶĚŽƌƐůŽĐĂƚĞĚŝŶŚƵůĂsŝƐƚĂ͘ &ŝƌŵWƌŝĐĞƐ WƌŝĐĞƐƐŚĂůůƌĞŵĂŝŶĨŝƌŵĨŽƌǀĞŚŝĐůĞƐƐƉĞĐŝĨŝĐĂůůǇůŝƐƚĞĚĨŽƌĂŵŝŶŝŵƵŵŽĨŶŝŶĞƚǇ;ϵϬͿĚĂǇƐĨƌŽŵƚŚĞďŝĚŽƉĞŶŝŶŐĚĂƚĞ͘ Wh>//^>K^hZ ůůƉƌŽƉŽƐĂůƐƐƵďŵŝƚƚĞĚŝŶƌĞƐƉŽŶƐĞƚŽƚŚŝƐZ&YďĞĐŽŵĞƚŚĞƉƌŽƉĞƌƚǇŽĨƚŚĞŝƚǇĂŶĚƉƵďůŝĐƌĞĐŽƌĚƐ͕ĂŶĚĂƐƐƵĐŚŵĂǇďĞƐƵďũĞĐƚ ƚŽƉƵďůŝĐƌĞǀŝĞǁ͘hŶĚĞƌƚŚĞĂůŝĨŽƌŶŝĂWƵďůŝĐZĞĐŽƌĚƐĐƚ;ĂůŝĨŽƌŶŝĂ'ŽǀĞƌŶŵĞŶƚŽĚĞ^ĞĐƚŝŽŶϲϮϱϬĞƚƐĞƋ͘ͿƌĞĐŽƌĚƐŝŶƚŚĞ ĐƵƐƚŽĚǇŽĨĂƉƵďůŝĐĞŶƚŝƚǇŐĞŶĞƌĂůůǇŚĂǀĞƚŽďĞĚŝƐĐůŽƐĞĚƵŶůĞƐƐƚŚĞŝŶĨŽƌŵĂƚŝŽŶďĞŝŶŐƐŽƵŐŚƚĨĂůůƐŝŶƚŽŽŶĞŽƌŵŽƌĞŽĨƚŚĞ ĞǆĞŵƉƚŝŽŶƐƚŽĚŝƐĐůŽƐƵƌĞƐĞƚŽƵƚŝŶ'ŽǀĞƌŶŵĞŶƚŽĚĞ^ĞĐƚŝŽŶƐϲϮϱϰƚŚƌŽƵŐŚϲϮϱϱ͘ ĐŽǀĞƌůĞƚƚĞƌƐŚŽƵůĚďĞƉƌŽǀŝĚĞĚǁŝƚŚƚŚĞZĞƋƵĞƐƚĨŽƌŝĚĐŽŶƚĂŝŶŝŶŐĂƉĂƌĂŐƌĂƉŚƚŚĂƚƐƚĂƚĞƐǁŚĞƚŚĞƌŽƌŶŽƚsĞŶĚŽƌďĞůŝĞǀĞƐ ƚŚĂƚŝƚƐƉƌŽƉŽƐĂůĚŽĞƐŽƌĚŽĞƐŶŽƚĐŽŶƚĂŝŶŝŶĨŽƌŵĂƚŝŽŶƚŚĂƚĨĂůůƐŝŶƚŽŽŶĞŽĨƚŚĞĞǆĞŵƉƚŝŽŶƐŽĨ'ŽǀĞƌŶŵĞŶƚŽĚĞ^ĞĐƚŝŽŶƐϲϮϱϰ ƚŚƌŽƵŐŚϲϮϱϱĂŶĚǁŚĞƚŚĞƌŽƌŶŽƚsĞŶĚŽƌĐŽŶƐŝĚĞƌƐƐƵĐŚŝŶĨŽƌŵĂƚŝŽŶƚŽďĞĐŽŶĨŝĚĞŶƚŝĂů͘ /ŶƚŚĞĂďƐĞŶĐĞŽĨĂĚĞĐůĂƌĂƚŝŽŶ͕ƚŚĞŝƚǇŵĂǇďĞŽďůŝŐĂƚĞĚƚŽĚŝƐĐůŽƐĞƚŚĞƉƌŽƉŽƐĂůƚŽĂŶǇƉĂƌƚǇƚŚĂƚƌĞƋƵĞƐƚƐŝƚ͘ZĞŐĂƌĚůĞƐƐŽĨ ĂƐƐĞƌƚŝŽŶƐŽĨĐŽŶĨŝĚĞŶƚŝĂůŝƚǇ͕ƉƌŽƉŽƐĂůĐŽŶƚĞŶƚƐŵĂǇƐƚŝůůďĞĚŝƐĐůŽƐĞĚŝĨŝƚǇ͕ŽƌĂĐŽƵƌƚǁŝƚŚũƵƌŝƐĚŝĐƚŝŽŶ͕ĚĞƚĞƌŵŝŶĞƐƚŚĂƚƐƵĐŚ ƉƌŽƉŽƐĂůŝƐĂƉƵďůŝĐƌĞĐŽƌĚƌĞƋƵŝƌŝŶŐĚŝƐĐůŽƐƵƌĞ͘ WĂǇŵĞŶƚdĞƌŵƐdĞƌŵƐ͗ͺͺͺͺͺͺͺͺйͺͺͺͺͺͺͺͺͺĂǇƐ Page 487 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϳͮWĂŐĞ WƌŽŵƉƚƉĂǇŵĞŶƚĚŝƐĐŽƵŶƚƐŽĨĨĞƌĞĚĨŽƌůĞƐƐƚŚĂŶĨŝĨƚĞĞŶ;ϭϱͿĚĂǇƐǁŝůůŶŽƚďĞĐŽŶƐŝĚĞƌĞĚŝŶĞǀĂůƵĂƚŝŶŐďŝĚƐĨŽƌĂǁĂƌĚ͘,ŽǁĞǀĞƌ͕ ĚŝƐĐŽƵŶƚƐŽĨĨĞƌĞĚŽĨůĞƐƐƚŚĂŶĨŝĨƚĞĞŶ;ϭϱͿĚĂǇƐǁŝůůďĞƚĂŬĞŶŝĨƉĂǇŵĞŶƚŝƐŵĂĚĞďǇƚŚĞŝƚǇǁŝƚŚŝŶƚŚĞĚŝƐĐŽƵŶƚƉĞƌŝŽĚ͘/ŶƚŚĞ ĂďƐĞŶĐĞŽĨƚĞƌŵƐ͕ƉĂǇŵĞŶƚƐŚĂůůďĞEĞƚdŚŝƌƚǇ;ϯϬͿĂǇƐ͘ WĂǇŵĞŶƚDĞƚŚŽĚ dŚĞŝƚǇ͛ƐƉƌĞĨĞƌƌĞĚƉĂǇŵĞŶƚŵĞƚŚŽĚŝƐ:͘W͘DŽƌŐĂŶ͛Ɛ^ŝŶŐůĞͲhƐĞĐĐŽƵŶƚƐ;^hͿǀŝƌƚƵĂůĐĂƌĚƉĂǇŵĞŶƚƉƌŽŐƌĂŵΎΎ;ƐĞĞďĞůŽǁ ĨŽƌ^hďĞŶĞĨŝƚƐͿ͕Žƌ&dͬ,͘WůĞĂƐĞĐŽŶĨŝƌŵǁŚĞƚŚĞƌǇŽƵƌĐŽŵƉĂŶǇĂĐĐĞƉƚƐƚŚĞƐĞĨŽƌŵƐŽĨƉĂǇŵĞŶƚĨŽƌŝŶǀŽŝĐĞƐ͘ ^h͗ zĞƐ EŽ &d͗ zĞƐEŽ /Ĩ^hŝƐŶŽƚĂĐĐĞƉƚĞĚ͕ƚŚĞŝƚǇǁŝůůŵĂŬĞƉĂǇŵĞŶƚƐƚŚƌŽƵŐŚůĞĐƚƌŽŶŝĐ&ƵŶĚƐdƌĂŶƐĨĞƌ;&dŽƌ,ͿĂŶĚǁŝůůŶĞĞĚƚŚĞŝŶĨŽƌŵĂƚŝŽŶ ďĞůŽǁ͗ ĂŶŬηͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ĂŶŬĐĐŽƵŶƚηͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ĂŶŬEĂŵĞͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ĂŶŬĚĚƌĞƐƐͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ŚĞĐŬŝŶŐŽƌ^ĂǀŝŶŐƐĐĐŽƵŶƚͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ΎΎĞŶĞĨŝƚƐŽĨ^hsŝƌƚƵĂůĂƌĚWĂǇŵĞŶƚWƌŽŐƌĂŵ dŚĞƌĞĂƌĞŵĂŶǇďĞŶĞĨŝƚƐǁŚĞŶĂĐĐĞƉƚŝŶŐ^hƉĂǇŵĞŶƚ͕ŝŶĐůƵĚŝŶŐ͗ xĂĐĐĞůĞƌĂƚĞĚƉĂǇŵĞŶƚƐƚŚĂƚǁŝůůŚĞůƉƌĞĚƵĐĞĚĂǇƐƐĂůĞƐŽƵƚƐƚĂŶĚŝŶŐ;^KͿ xĂƐŝŵƉůŝĨŝĞĚƉƌŽĐĞƐƐƚŚĂƚĞůŝŵŝŶĂƚĞƐƚŚĞĐŽƐƚŽĨƉƌŽĐĞƐƐŝŶŐĐŚĞĐŬƐ xƚŚĞĂďŝůŝƚǇƚŽƌĞĚƵĐĞĂĚŵŝŶŝƐƚƌĂƚŝŽŶĞǆƉĞŶƐĞƐ͕ĂĐĐŽƵŶƚĐŽůůĞĐƚŝŽŶƐĂŶĚĨŽůůŽǁͲƵƉƐ xƵƉŽŶǇŽƵƌĞŶƌŽůůŵĞŶƚŝŶŽƵƌ^hƉƌŽŐƌĂŵ͕ǁĞǁŝůůĐŽŶǀĞƌƚǇŽƵƌƉĂǇŵĞŶƚƚĞƌŵƐƚŽEĞƚϭϱĚĂǇƐ ŶƌŽůůŝŶŐŝŶƚŚŝƐŝŶŝƚŝĂƚŝǀĞĐĂŶŚĞůƉƐƚƌĞŶŐƚŚĞŶŽƵƌďƵƐŝŶĞƐƐƌĞůĂƚŝŽŶƐŚŝƉ͕ĂŶĚǁĞĂƌĞƐƚƌŽŶŐůǇĐŽŵŵŝƚƚĞĚƚŽĂĐŚŝĞǀŝŶŐϭϬϬй ƉĂƌƚŝĐŝƉĂƚŝŽŶĨƌŽŵŽƵƌǀĂůƵĞĚƐƵƉƉůŝĞƌƐ͘ WƵďůŝĐŐĞŶĐǇWĂƌƚŝĐŝƉĂƚŝŽŶ KƚŚĞƌƉƵďůŝĐĂŐĞŶĐŝĞƐ;Ğ͘Ő͘ĐŝƚǇ͕ĐŽƵŶƚǇ͕ƉƵďůŝĐĐŽƌƉŽƌĂƚŝŽŶ͕ƉŽůŝƚŝĐĂůƐƵďĚŝǀŝƐŝŽŶ͕ƐĐŚŽŽůĚŝƐƚƌŝĐƚ͕ŽƌǁĂƚĞƌĂƵƚŚŽƌŝƚǇͿŵĂǇǁĂŶƚƚŽ ƉĂƌƚŝĐŝƉĂƚĞŝŶĂŶǇĂǁĂƌĚĂƐĂƌĞƐƵůƚŽĨƚŚŝƐďŝĚ͘dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂƐŚĂůůŝŶĐƵƌŶŽĨŝŶĂŶĐŝĂůƌĞƐƉŽŶƐŝďŝůŝƚǇŝŶĐŽŶŶĞĐƚŝŽŶǁŝƚŚ ĂŶǇƉƵƌĐŚĂƐĞďǇĂŶŽƚŚĞƌƉƵďůŝĐĂŐĞŶĐǇ͘dŚĞƉƵďůŝĐĂŐĞŶĐǇƐŚĂůůĂĐĐĞƉƚƐŽůĞƌĞƐƉŽŶƐŝďŝůŝƚǇĨŽƌƉůĂĐŝŶŐŽƌĚĞƌƐĂŶĚŵĂŬŝŶŐƉĂǇŵĞŶƚƐ ƚŽƚŚĞƐƵĐĐĞƐƐĨƵůƌĞƐƉŽŶĚĞŶƚ͘dŚŝƐŽƉƚŝŽŶǁŝůůŶŽƚďĞĐŽŶƐŝĚĞƌĞĚŝŶďŝĚĞǀĂůƵĂƚŝŽŶ͘WůĞĂƐĞŝŶĚŝĐĂƚĞǁŚĞƚŚĞƌƚŚŝƐǁŝůůďĞŐƌĂŶƚĞĚ͘ zĞƐͺͺͺͺͺͺͺͺEŽͺͺͺͺͺͺͺͺ ƵƐŝŶĞƐƐ>ŝĐĞŶƐĞ ƵƐŝŶĞƐƐ>ŝĐĞŶƐĞŝƐƌĞƋƵŝƌĞĚĂƐŽƵƚůŝŶĞĚŝŶƚŚĞŚƵůĂsŝƐƚĂDƵŶŝĐŝƉĂůŽĚĞ^ĞĐƚŝŽŶϱ͘ϬϮ͘ϬϮϬ͕ǁŚŝĐŚƐƚĂƚĞƐ͗/ƚŝƐƵŶůĂǁĨƵůĨŽƌ ĂŶǇƉĞƌƐŽŶ͕ŽƌĨŽƌĂŶǇƉĞƌƐŽŶĂƐĂŐĞŶƚ͕ĐůĞƌŬŽƌĞŵƉůŽǇĞĞ͕ĞŝƚŚĞƌĨŽƌŚŝŵƐĞůĨŽƌĨŽƌĂŶǇŽƚŚĞƌƉĞƌƐŽŶ͕ǁŝƚŚŝŶƚŚĞĐŽƌƉŽƌĂƚĞůŝŵŝƚƐ ŽĨƚŚĞŝƚǇ͕ƚŽƚƌĂŶƐĂĐƚ͕ĞŶŐĂŐĞŝŶ͕ŽƌĐĂƌƌǇŽŶĂŶǇďƵƐŝŶĞƐƐ͕ƐŚŽǁ͕ĞǆŚŝďŝƚŝŽŶŽƌŐĂŵĞŚĞƌĞŝŶĂĨƚĞƌƐƉĞĐŝĨŝĞĚǁŝƚŚŽƵƚĨŝƌƐƚŚĂǀŝŶŐ ƉƌŽĐƵƌĞĚĂůŝĐĞŶƐĞ͘ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ^ŝŐŶĂƚƵƌĞ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ĂƚĞ dŚŝƐƉĂŐĞŵƵƐƚďĞĐŽŵƉůĞƚĞĚĂŶĚƌĞƚƵƌŶĞĚǁŝƚŚƌĞƐƉŽŶƐĞ͘ Page 488 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϴͮWĂŐĞ WZKWK^>'EZ>WZKs/^/KE^ WůĞĂƐĞZĞĂĚĂƌĞĨƵůůǇ dŚĞƐĞWƌŽǀŝƐŝŽŶƐƌĞĂWĂƌƚŽĨzŽƵƌWƌŽƉŽƐĂůĂŶĚĂŶǇŽŶƚƌĂĐƚǁĂƌĚĞĚ dŚĞďŝĚĚĞƌĂŐƌĞĞƐƚŚĂƚ͗ ͘ ŝĚĚĞƌŚĂƐĐĂƌĞĨƵůůǇĞǆĂŵŝŶĞĚƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐ͕ĂŶĚĂůůƉƌŽǀŝƐŝŽŶƐƌĞůĂƚŝŶŐƚŽƚŚĞŝƚĞŵ;ƐͿƚŽďĞĨƵƌŶŝƐŚĞĚ ŽƌƚŚĞǁŽƌŬƚŽďĞĚŽŶĞ͖ƵŶĚĞƌƐƚĂŶĚƐƚŚĞŵĞĂŶŝŶŐ͕ŝŶƚĞŶƚ͕ĂŶĚƌĞƋƵŝƌĞŵĞŶƚƐ͖ĂŶĚ ͘ ŝĚĚĞƌǁŝůůĞŶƚĞƌŝŶƚŽĂǁƌŝƚƚĞŶĐŽŶƚƌĂĐƚĂŶĚĨƵƌŶŝƐŚƚŚĞŝƚĞŵ;ƐͿŽƌĐŽŵƉůĞƚĞƚŚĞǁŽƌŬŝŶƚŚĞƚŝŵĞƐƉĞĐŝĨŝĞĚ͕ ĂŶĚŝŶƐƚƌŝĐƚĐŽŶĨŽƌŵŝƚǇǁŝƚŚƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂƐƉĞĐŝĨŝĐĂƚŝŽŶƐĨŽƌƚŚĞƉƌŝĐĞƐƋƵŽƚĞĚ͘ EŽƚĞ͗ ŝĚĚĞƌŝƐĚĞĨŝŶĞĚĂƐĂŶǇŝŶĚŝǀŝĚƵĂů͕ƉĂƌƚŶĞƌƐŚŝƉ͕ŽƌĐŽƌƉŽƌĂƚŝŽŶƐƵďŵŝƚƚŝŶŐĂďŝĚ͕ƉƌŽƉŽƐĂů͕ŽƌƋƵŽƚĂƚŝŽŶŝŶ ƌĞƐƉŽŶƐĞƚŽĂƌĞƋƵĞƐƚĨŽƌďŝĚ͕ƌĞƋƵĞƐƚĨŽƌƉƌŽƉŽƐĂů͕ŽƌƌĞƋƵĞƐƚĨŽƌƋƵŽƚĂƚŝŽŶ͘ďŝĚĚĞƌŵĂǇĂůƐŽďĞƌĞĨĞƌƌĞĚ ƚŽĂƐĐŽŶƐƵůƚĂŶƚ͕ĐŽŶƚƌĂĐƚŽƌ͕ŽƉĞƌĂƚŽƌ͕ƐƵƉƉůŝĞƌ͕ŽƌǀĞŶĚŽƌ͘ ŝĚŝƐĚĞĨŝŶĞĚĂƐĂŶǇďŝĚ͕ƉƌŽƉŽƐĂů͕ŽƌƋƵŽƚĂƚŝŽŶƐƵďŵŝƚƚĞĚŝŶƌĞƐƉŽŶƐĞƚŽƚŚŝƐƐŽůŝĐŝƚĂƚŝŽŶ͘ ϭ͘/ƚĞŵƐKĨĨĞƌĞĚ /ĨƚŚĞŝƚĞŵŽĨĨĞƌĞĚŚĂƐĂƚƌĂĚĞŶĂŵĞ͕ďƌĂŶĚĂŶĚͬŽƌĐĂƚĂůŽŐŶƵŵďĞƌ͕ƐƵĐŚƐŚĂůůďĞƐƚĂƚĞĚŝŶƚŚĞďŝĚ͘/ĨƚŚĞďŝĚĚĞƌ ƉƌŽƉŽƐĞƐƚŽĨƵƌŶŝƐŚĂŶŝƚĞŵŽĨĂŵĂŶƵĨĂĐƚƵƌĞƌŽƌǀĞŶĚŽƌŽƚŚĞƌƚŚĂŶƚŚĂƚŵĞŶƚŝŽŶĞĚŽŶƚŚĞĨĂĐĞŚĞƌĞŽĨ͕ďŝĚĚĞƌ ŵƵƐƚƐƉĞĐŝĨǇŵĂŬĞƌ͕ďƌĂŶĚ͕ƋƵĂůŝƚǇ͕ĐĂƚĂůŽŐŶƵŵďĞƌ͕ŽƌŽƚŚĞƌƚƌĂĚĞĚĞƐŝŐŶĂƚŝŽŶ͘hŶůĞƐƐƐƵĐŚŝƐŶŽƚĞĚŽŶƚŚĞďŝĚ ĨŽƌŵ͕ŝƚǁŝůůďĞĚĞĞŵĞĚƚŚĂƚƚŚĞŝƚĞŵŽĨĨĞƌĞĚŝƐƚŚĂƚĚĞƐŝŐŶĂƚĞĚĞǀĞŶƚŚŽƵŐŚƚŚĞďŝĚŵĂǇƐƚĂƚĞŽƌĞƋƵĂů͘ Ϯ͘^ĂŵƉůĞƐ ^ĂŵƉůĞƐŵĂǇďĞƌĞƋƵŝƌĞĚĨŽƌďŝĚĞǀĂůƵĂƚŝŽŶĂŶĚƚĞƐƚŝŶŐƉƵƌƉŽƐĞƐ͘ŝĚĚĞƌƐƐŚĂůůĂŐƌĞĞƚŽƉƌŽǀŝĚĞƐĂŵƉůĞƐǁŝƚŚŝŶ ĨŽƌƚǇͲĞŝŐŚƚ;ϰϴͿŚŽƵƌƐƵƉŽŶƌĞƋƵĞƐƚĂŶĚĂƚŶŽĂĚĚŝƚŝŽŶĂůĐŽƐƚƚŽƚŚĞŝƚǇ ϯ͘sĞƌŝĨǇYƵŽƚĂƚŝŽŶƐ WƌŝĐĞƐƐŚĂůůďĞǀĞƌŝĨŝĞĚƉƌŝŽƌƚŽďŝĚƐƵďŵŝƚƚĂů͕ĂƐǁŝƚŚĚƌĂǁĂůŽƌĐŽƌƌĞĐƚŝŽŶŵĂǇŶŽƚďĞƉĞƌŵŝƚƚĞĚĂĨƚĞƌƚŚĞďŝĚ ŚĂƐďĞĞŶŽƉĞŶĞĚ͘ ϰ͘&ŝƌŵWƌŝĐĞƐ WƌŝĐĞƐŽŶďŝĚƐŚĂůůďĞĨŝƌŵƉƌŝĐĞƐŶŽƚƐƵďũĞĐƚƚŽĞƐĐĂůĂƚŝŽŶ͘/ŶƚŚĞĞǀĞŶƚƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐƉƌŽǀŝĚĞĨŽƌĞƐĐĂůĂƚŝŽŶ͕ ƚŚĞŵĂǆŝŵƵŵůŝŵŝƚƐŚĂůůďĞƐŚŽǁŶ͕ŽƌƚŚĞďŝĚƐŚĂůůŶŽƚďĞĐŽŶƐŝĚĞƌĞĚ͘/ŶƚŚĞĞǀĞŶƚŽĨĂĚĞĐůŝŶĞŝŶŵĂƌŬĞƚƉƌŝĐĞ ďĞůŽǁĂƉƌŝĐĞďŝĚ͕ƚŚĞŝƚǇƐŚĂůůƌĞĐĞŝǀĞƚŚĞďĞŶĞĨŝƚŽĨƐƵĐŚĚĞĐůŝŶĞ͘ ϱ͘DŽĚŝĨŝĐĂƚŝŽŶŽƌtŝƚŚĚƌĂǁĂůŽĨŝĚƐ ŝĚƐŵĂǇďĞŵŽĚŝĨŝĞĚŽƌǁŝƚŚĚƌĂǁŶďǇǁƌŝƚƚĞŶŽƌĨĂĐƐŝŵŝůĞŶŽƚŝĐĞƌĞĐĞŝǀĞĚƉƌŝŽƌƚŽƚŚĞĞǆĂĐƚŚŽƵƌĂŶĚĚĂƚĞ ƐƉĞĐŝĨŝĞĚĨŽƌƌĞĐĞŝƉƚŽĨďŝĚ͘ďŝĚŵĂǇĂůƐŽďĞǁŝƚŚĚƌĂǁŶŝŶƉĞƌƐŽŶďǇĂďŝĚĚĞƌ͕ŽƌĂƵƚŚŽƌŝǌĞĚƌĞƉƌĞƐĞŶƚĂƚŝǀĞ͕ ƉƌŝŽƌƚŽƚŚĞĞǆĂĐƚŚŽƵƌĂŶĚĚĂƚĞƐĞƚĨŽƌƌĞĐĞŝƉƚŽĨďŝĚƐ͘dĞůĞƉŚŽŶĞǁŝƚŚĚƌĂǁĂůƐĂƌĞŶŽƚƉĞƌŵŝƚƚĞĚ͘ ϲ͘>ĂƚĞŝĚƐ͕DŽĚŝĨŝĐĂƚŝŽŶƐ͕ŽƌtŝƚŚĚƌĂǁĂůƐ ĂͿŝĚƐ͕ŵŽĚŝĨŝĐĂƚŝŽŶƐŽĨďŝĚƐ͕ŽƌďŝĚǁŝƚŚĚƌĂǁĂůƐƌĞĐĞŝǀĞĚĂĨƚĞƌƚŚĞĞǆĂĐƚƚŝŵĞĂŶĚĚĂƚĞƐƉĞĐŝĨŝĞĚĨŽƌƌĞĐĞŝƉƚ ǁŝůůŶŽƚďĞĐŽŶƐŝĚĞƌĞĚƵŶůĞƐƐƌĞĐĞŝƉƚŝƐďĞĨŽƌĞƚŚĞĐŽŶƚƌĂĐƚŝƐĂǁĂƌĚĞĚĂŶĚƚŚĞŝƚǇĚĞƚĞƌŵŝŶĞƐƚŚĂƚůĂƚĞ ƌĞĐĞŝƉƚǁĂƐĚƵĞƐŽůĞůǇƚŽŝƚǇĞƌƌŽƌ͘ EDŽĚŝĨŝĐĂƚŝŽŶŽĨĂƐƵĐĐĞƐƐĨƵůďŝĚƚŚĂƚŵĂŬĞƐƚŚĞƚĞƌŵƐŽĨƚŚĞďŝĚŵŽƌĞ ĨĂǀŽƌĂďůĞƚŽƚŚĞŝƚǇ ǁŝůůďĞ ĐŽŶƐŝĚĞƌĞĚĂƚĂŶǇƚŝŵĞ͘ Page 489 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϵͮWĂŐĞ ϳ͘DŝƐƚĂŬĞŝŶŝĚ ĂͿ/ĨƚŚĞďŝĚĚĞƌĚŝƐĐŽǀĞƌƐĂŵŝƐƚĂŬĞŝŶďŝĚƉƌŝŽƌƚŽƚŚĞŚŽƵƌĂŶĚĚĂƚĞƐƉĞĐŝĨŝĞĚĨŽƌƌĞĐĞŝƉƚŽĨďŝĚ͕ďŝĚĚĞƌŵĂǇ ĐŽƌƌĞĐƚƚŚĞŵŝƐƚĂŬĞďǇŵŽĚŝĨǇŝŶŐŽƌǁŝƚŚĚƌĂǁŝŶŐƚŚĞďŝĚŝŶĂĐĐŽƌĚĂŶĐĞƚŚĞƐĞƉƌŽǀŝƐŝŽŶƐ͘ ďͿ/ĨǁŝƚŚŝŶƐĞǀĞŶƚǇͲƚǁŽŚŽƵƌƐŽĨƚŚĞďŝĚĐůŽƐŝŶŐĂŶĚƉƌŝŽƌƚŽƚŚĞŝƐƐƵĂŶĐĞŽĨĂƉƵƌĐŚĂƐĞŽƌĚĞƌŽƌĂĐŽŶƚƌĂĐƚ͕ ƚŚĞďŝĚĚĞƌĚŝƐĐŽǀĞƌƐĂŵŝƐƚĂŬĞŝŶŝƚƐďŝĚŽĨĂƐĞƌŝŽƵƐĂŶĚƐŝŐŶŝĨŝĐĂŶƚŶĂƚƵƌĞǁŚŝĐŚŝƐƵŶĨĂǀŽƌĂďůĞƚŽďŝĚĚĞƌ͕ ďŝĚĚĞƌŵĂǇƌĞƋƵĞƐƚĐŽŶƐŝĚĞƌĂƚŝŽŶďĞŐŝǀĞŶƚŽŵŽĚŝĨǇŝŶŐƚŚĞďŝĚŝĨŝƚƌĞŵĂŝŶƐƚŚĞůŽǁĞƐƚďŝĚŽƌƚŽ ǁŝƚŚĚƌĂǁĂůŽĨƚŚĞďŝĚŝĨƚŚĞƌĞƐƵůƚŽĨƚŚĞĐŽƌƌĞĐƚŝŽŶŽĨƚŚĞŵŝƐƚĂŬĞŵĂŬĞƐĂŶŽƚŚĞƌďŝĚĚĞƌůŽǁĞƐƚĂŶĚďĞƐƚ ďŝĚĚĞƌ͘dŚĞŵŝƐƚĂŬĞŵƵƐƚďĞĞǀŝĚĞŶƚĂŶĚƉƌŽǀĂďůĞ͘dŚĞƌŝŐŚƚŝƐƌĞƐĞƌǀĞĚďǇƚŚĞŝƚǇƚŽƌĞũĞĐƚĂŶǇĂŶĚĂůů ƌĞƋƵĞƐƚƐĨŽƌĐŽƌƌĞĐƚŝŽŶŽĨŵŝƐƚĂŬĞƐŝŶďŝĚƐƌĞĐĞŝǀĞĚĂĨƚĞƌƚŚĞŚŽƵƌĂŶĚĚĂƚĞŽĨƚŚĞďŝĚĐůŽƐŝŶŐ͘dŚĞ ĚĞĐŝƐŝŽŶŽĨƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚŝƐĨŝŶĂůĂƐƌĞŐĂƌĚƐĂĐĐĞƉƚĂŶĐĞŽƌƌĞũĞĐƚŝŽŶŽĨƌĞƋƵĞƐƚƐĨŽƌĐŽƌƌĞĐƚŝŽŶŽĨ ďŝĚƐ͘ ĐͿŵŝƐƚĂŬĞŝŶďŝĚĐĂŶŶŽƚďĞĐŽŶƐŝĚĞƌĞĚŽŶĐĞĂƉƵƌĐŚĂƐĞŽƌĚĞƌŽƌĐŽŶƚƌĂĐƚŝƐŝƐƐƵĞĚ͘ ϴ͘^ŝŐŶĂƚƵƌĞ ůůďŝĚƐƐŚĂůůďĞƐŝŐŶĞĚ͕ĂŶĚƚŚĞƚŝƚůĞĂŶĚĨŝƌŵŶĂŵĞŝŶĚŝĐĂƚĞĚ͘ďŝĚďǇĂĐŽƌƉŽƌĂƚŝŽŶƐŚĂůůďĞƐŝŐŶĞĚďǇĂŶ ĂƵƚŚŽƌŝǌĞĚŽĨĨŝĐĞƌ͕ĞŵƉůŽǇĞĞŽƌĂŐĞŶƚǁŝƚŚŚŝƐŽƌŚĞƌƚŝƚůĞ͘ ͘ ϵ͘ůƚĞƌŶĂƚŝǀĞWƌŽƉŽƐĂůƐ dŽďĞƌĞƐƉŽŶƐŝǀĞƚŽƚŚĞďŝĚ͕ďŝĚĚĞƌŵƵƐƚƐƵďŵŝƚĂƉƌŽƉŽƐĂůƚŚĂƚ ŵĞĞƚƐĂůůƐƉĞĐŝĨŝĐďŝĚƌĞƋƵŝƌĞŵĞŶƚƐ͘KŶĐĞďŝĚĚĞƌ ŚĂƐƉƌŽƉŽƐĞĚĂƉƌŽĚƵĐƚǁŚŝĐŚŝƐƌĞƐƉŽŶƐŝǀĞƚŽƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶ͕ďŝĚĚĞƌŵĂǇŝŶĐůƵĚĞǁŝƚŚƚŚĞďŝĚĂŶǇĂĚĚŝƚŝŽŶĂů ƉƌŽƉŽƐĂůƐŽƌĂůƚĞƌŶĂƚŝǀĞƉƌŽĚƵĐƚƐƚŚĂƚďŝĚĚĞƌďĞůŝĞǀĞƐĐĂŶŵĞĞƚŽƌĞǆĐĞĞĚƚŚĞŝƚǇ͛ƐƌĞƋƵŝƌĞŵĞŶƚƐĂŶĚƚŚĂƚŵĂǇ ŽĨĨĞƌĂĚĚŝƚŝŽŶĂůĂĚǀĂŶƚĂŐĞƐ͕ďĞŶĞĨŝƚƐ͕ŽƌĐŽƐƚƐĂǀŝŶŐƐ͘dŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĞǀĂůƵĂƚĞ͕ĂŶĚĂĐĐĞƉƚŽƌ ƌĞũĞĐƚ͕ƐƵĐŚĂůƚĞƌŶĂƚŝǀĞƐĂƐƚŚŽƵŐŚƚŚĞǇǁĞƌĞƉĂƌƚŽĨƚŚĞŽƌŝŐŝŶĂůƐƉĞĐŝĨŝĐĂƚŝŽŶƐǁŝƚŚŽƵƚĂĚǀĞƌƚŝƐŝŶŐĨŽƌĨƵƌƚŚĞƌ ďŝĚƐ͕ǁŚĞŶŝŶƚŚĞďĞƐƚŝŶƚĞƌĞƐƚƐŽĨƚŚĞŝƚǇ͘ŶǇĂǁĂƌĚƐƐŽŵĂĚĞǁŝůůďĞďĂƐĞĚŽŶŽƉĞƌĂƚŝŽŶĂůĂŶĚĐŽƐƚĂŶĂůǇƐŝƐ ĐŽŶƐŝĚĞƌĂƚŝŽŶƐƚŚĂƚǁŽƵůĚƌĞƐƵůƚŝŶƚŚĞŽƉƚŝŵƵŵĞĐŽŶŽŵŝĐĂĚǀĂŶƚĂŐĞƚŽƚŚĞŝƚǇ͘ ϭϬ͘ŶǀŝƌŽŶŵĞŶƚĂůůǇWƌĞĨĞƌĂďůĞWƵƌĐŚĂƐŝŶŐ;WWͿ dŚĞŝƚǇĚĞĨŝŶĞƐŶǀŝƌŽŶŵĞŶƚĂůůǇWƌĞĨĞƌĂďůĞWƵƌĐŚĂƐŝŶŐ;WWͿĂƐƚŚĞƉƌŽĐƵƌĞŵĞŶƚŽƌĂĐƋƵŝƐŝƚŝŽŶŽĨŐŽŽĚƐĂŶĚ ƐĞƌǀŝĐĞƐƚŚĂƚŚĂǀĞĂůĞƐƐĞƌŽƌƌĞĚƵĐĞĚĞĨĨĞĐƚŽŶŚƵŵĂŶŚĞĂůƚŚĂŶĚƚŚĞĞŶǀŝƌŽŶŵĞŶƚǁŚĞŶĐŽŵƉĂƌĞĚǁŝƚŚ ĐŽŵƉĞƚŝŶŐŐŽŽĚƐŽƌƐĞƌǀŝĐĞƚŚĂƚƐĞƌǀĞƚŚĞƐĂŵĞƉƵƌƉŽƐĞ͘tŝƚŚĨĞǁĞǆĐĞƉƚŝŽŶƐ͕ĞŶǀŝƌŽŶŵĞŶƚĂůůǇƉƌĞĨĞƌĂďůĞ ƉƌŽĚƵĐƚƐƐŚĂůůŽŶůǇďĞƉƵƌĐŚĂƐĞĚǁŚĞŶĚĞƚĞƌŵŝŶĞĚƚŽďĞĐŽƐƚͲĞĨĨĞĐƚŝǀĞǁŚŝůĞĐŽŶƐŝĚĞƌŝŶŐĂƚƌƵĞĐŽƐƚĚƵƌŝŶŐŝƚƐ ůŝĨĞĐǇĐůĞ ĨƌŽŵ ƵƐĞ͕ ŵĂŶĂŐĞŵĞŶƚ ĂŶĚ ĚŝƐƉŽƐĂů͘ WW ƌĞƋƵŝƌĞƐ ĂƚƚĞŶƚŝŽŶ ƚŽ ŶƵŵĞƌŽƵƐ ĞŶǀŝƌŽŶŵĞŶƚĂů ĐŽŶƐŝĚĞƌĂƚŝŽŶƐ͕ ŝŶĐůƵĚŝŶŐ ĞŶĞƌŐǇ ĞĨĨŝĐŝĞŶĐǇ͕ ƉŽƐƚĐŽŶƐƵŵĞƌ ƌĞĐǇĐůĞĚĐŽŶƚĞŶƚ͕ǁĂƚĞƌĞĨĨŝĐŝĞŶĐǇ͕ůŽǁͬǌĞƌŽ ŚĂǌĂƌĚŽƵƐ ƐƵďƐƚĂŶĐĞƐ ĂŶĚ ƌĞƐƉŽŶƐŝďůĞ ŵĂŶƵĨĂĐƚƵƌŝŶŐ͕ ƚŽ ŶĂŵĞ ũƵƐƚ Ă ĨĞǁ͘ dĞƐƚŝŶŐ ĂŶĚ ĞǀĂůƵĂƚŝŽŶ ŽĨ ĞŶǀŝƌŽŶŵĞŶƚĂůůǇƉƌĞĨĞƌĂďůĞƉƌŽĚƵĐƚƐŝƐŽŶĞĂůůŽǁĂďůĞĞǆĐĞƉƚŝŽŶĂŶĚŵĂǇďĞƌĞƋƵĞƐƚĞĚĂƚĂŶǇƚŝŵĞĚƵƌŝŶŐƚŚĞ ƐŽůŝĐŝƚĂƚŝŽŶƉƌŽĐĞƐƐ͘ &ŽƌŵŽƌĞŝŶĨŽƌŵĂƚŝŽŶ͕ƉůĞĂƐĞĐŽŶƐƵůƚƚŚĞĂůZĞĐǇĐůĞǁĞďƐŝƚĞĂƚ͗ŚƚƚƉƐ͗ͬͬǁǁǁ͘ĐĂůƌĞĐǇĐůĞ͘ĐĂ͘ŐŽǀͬĞƉƉ͘ ϭϭ͘YƵĂůŝƚǇ hŶůĞƐƐŽƚŚĞƌǁŝƐĞƌĞƋƵŝƌĞĚŝŶƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐ͕ĂůůŐŽŽĚƐĨƵƌŶŝƐŚĞĚƐŚĂůůďĞŶĞǁĂŶĚƵŶƵƐĞĚ͘ ϭϮ͘>ŝƚŝŐĂƚŝŽŶtĂƌƌĂŶƚǇ dŚĞďŝĚĚĞƌ͕ďǇďŝĚĚŝŶŐ͕ǁĂƌƌĂŶƚƐƚŚĂƚďŝĚĚĞƌŝƐŶŽƚĐƵƌƌĞŶƚůǇŝŶǀŽůǀĞĚŝŶůŝƚŝŐĂƚŝŽŶŽƌĂƌďŝƚƌĂƚŝŽŶĐŽŶĐĞƌŶŝŶŐƚŚĞ ŵĂƚĞƌŝĂůƐŽƌďŝĚĚĞƌ͛ƐƉĞƌĨŽƌŵĂŶĐĞĐŽŶĐĞƌŶŝŶŐƚŚĞƐĂŵĞŽƌƐŝŵŝůĂƌŵĂƚĞƌŝĂůŽƌƐĞƌǀŝĐĞƚŽďĞƐƵƉƉůŝĞĚƉƵƌƐƵĂŶƚ ƚŽƚŚŝƐĐŽŶƚƌĂĐƚŽĨƐƉĞĐŝĨŝĐĂƚŝŽŶ͕ĂŶĚƚŚĂƚŶŽũƵĚŐŵĞŶƚƐŽƌĂǁĂƌĚƐŚĂǀĞďĞĞŶŵĂĚĞĂŐĂŝŶƐƚďŝĚĚĞƌŽŶƚŚĞďĂƐŝƐ Page 490 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϬͮWĂŐĞ ŽĨďŝĚĚĞƌ͛ƐƉĞƌĨŽƌŵĂŶĐĞŝŶƐƵƉƉůǇŝŶŐŽƌŝŶƐƚĂůůŝŶŐƚŚĞƐĂŵĞŽƌƐŝŵŝůĂƌŵĂƚĞƌŝĂůŽƌƐĞƌǀŝĐĞ͕ƵŶůĞƐƐƐƵĐŚĨĂĐƚŝƐ ĚŝƐĐůŽƐĞĚƚŽƚŚĞŝƚǇŝŶƚŚĞďŝĚ͘ŝƐĐůŽƐƵƌĞŵĂǇŶŽƚĚŝƐƋƵĂůŝĨǇƚŚĞďŝĚĚĞƌ͘dŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĞǀĂůƵĂƚĞ ďŝĚƐŽŶƚŚĞďĂƐŝƐŽĨƚŚĞĨĂĐƚƐƐƵƌƌŽƵŶĚŝŶŐƐƵĐŚůŝƚŝŐĂƚŝŽŶŽƌĂƌďŝƚƌĂƚŝŽŶĂŶĚƚŽƌĞƋƵŝƌĞďŝĚĚĞƌƚŽĨƵƌŶŝƐŚƚŚĞŝƚǇ ǁŝƚŚĂƐƵƌĞƚǇďŽŶĚĞǆĞĐƵƚĞĚďǇĂƐƵƌĞƚǇĐŽŵƉĂŶǇĂƵƚŚŽƌŝǌĞĚƚŽĚŽďƵƐŝŶĞƐƐŝŶƚŚĞ^ƚĂƚĞŽĨĂůŝĨŽƌŶŝĂĂŶĚ ĂƉƉƌŽǀĞĚďǇdŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŝŶĂƐƵŵĞƋƵĂůƚŽŽŶĞŚƵŶĚƌĞĚƉĞƌĐĞŶƚ;ϭϬϬйͿŽĨƚŚĞĐŽŶƚƌĂĐƚƉƌŝĐĞ ĐŽŶĚŝƚŝŽŶĂůŽŶƚŚĞĨĂŝƚŚĨƵůƉĞƌĨŽƌŵĂŶĐĞďǇďŝĚĚĞƌŽĨƚŚĞĐŽŶƚƌĂĐƚŝŶƚŚĞĞǀĞŶƚƚŚĞďŝĚŝƐĂǁĂƌĚĞĚƚŽďŝĚĚĞƌ͕ ŶŽƚǁŝƚŚƐƚĂŶĚŝŶŐƚŚĞůŝƚŝŐĂƚŝŽŶŽƌĂƌďŝƚƌĂƚŝŽŶ͘ ϭϯ͘WĞƌĨŽƌŵĂŶĐĞ^ƚĂŶĚĂƌĚƐ WĞƌĨŽƌŵĂŶĐĞŽĨǁŽƌŬĂŶĚĂĐĐĞƉƚĂďŝůŝƚǇŽĨĞƋƵŝƉŵĞŶƚŽƌŵĂƚĞƌŝĂůƐƐƵƉƉůŝĞĚƉƵƌƐƵĂŶƚƚŽĂŶǇĐŽŶƚƌĂĐƚŽƌĂǁĂƌĚ ƐŚĂůůďĞƚŽƚŚĞƐĂƚŝƐĨĂĐƚŝŽŶŽĨƚŚĞŝƚǇ͘ ϭϰ͘tĂƌƌĂŶƚŝĞƐ ĂͿůů ŵĂƚĞƌŝĂů͕ ůĂďŽƌ Žƌ ĞƋƵŝƉŵĞŶƚ ƉƌŽǀŝĚĞĚ ƵŶĚĞƌ ƚŚĞ ĐŽŶƚƌĂĐƚ ƐŚĂůů ďĞ ǁĂƌƌĂŶƚĞĚ ďǇ ďŝĚĚĞƌ ĂŶĚͬŽƌ ŵĂŶƵĨĂĐƚƵƌĞƌĨŽƌĂƚůĞĂƐƚƚǁĞůǀĞ;ϭϮͿŵŽŶƚŚƐĂĨƚĞƌĂĐĐĞƉƚĂŶĐĞďǇŝƚǇ͘'ƌĞĂƚĞƌǁĂƌƌĂŶƚǇƉƌŽƚĞĐƚŝŽŶǁŝůů ďĞĂĐĐĞƉƚĞĚ͘>ĞƐƐĞƌǁĂƌƌĂŶƚǇƉƌŽƚĞĐƚŝŽŶŵƵƐƚďĞŝŶĚŝĐĂƚĞĚďǇďŝĚĚĞƌŽŶƚŚĞďŝĚƉƌŽƉŽƐĂůĂƐĂŶĞǆĐĞƉƚŝŽŶ ďͿŝĚĚĞƌ ƐŚĂůů ďĞ ĐŽŶƐŝĚĞƌĞĚ ƉƌŝŵĂƌŝůǇ ƌĞƐƉŽŶƐŝďůĞ ƚŽ ƚŚĞ ŝƚǇ ĨŽƌ Ăůů ǁĂƌƌĂŶƚǇ ƐĞƌǀŝĐĞ͕ ƉĂƌƚƐ ĂŶĚ ůĂďŽƌ ĂƉƉůŝĐĂďůĞƚŽƚŚĞŐŽŽĚƐŽƌĞƋƵŝƉŵĞŶƚƉƌŽǀŝĚĞĚďǇďŝĚĚĞƌƵŶĚĞƌƚŚŝƐďŝĚŽƌĂǁĂƌĚ͕ŝƌƌĞƐƉĞĐƚŝǀĞŽĨǁŚĞƚŚĞƌ ďŝĚĚĞƌŝƐĂŶĂŐĞŶƚ͕ďƌŽŬĞƌ͕ĨĂďƌŝĐĂƚŽƌŽƌŵĂŶƵĨĂĐƚƵƌĞƌ͛ƐĚĞĂůĞƌ͘ŝĚĚĞƌƐŚĂůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĞŶƐƵƌŝŶŐ ƚŚĂƚǁĂƌƌĂŶƚǇǁŽƌŬŝƐƉĞƌĨŽƌŵĞĚĂƚĂůŽĐĂůĂŐĞŶĐǇŽƌĨĂĐŝůŝƚǇĐŽŶǀĞŶŝĞŶƚƚŽŝƚǇĂŶĚƚŚĂƚƐĞƌǀŝĐĞƐ͕ƉĂƌƚƐ ĂŶĚůĂďŽƌĂƌĞĂǀĂŝůĂďůĞĂŶĚƉƌŽǀŝĚĞĚƚŽŵĞĞƚŝƚǇ͛ƐƐĐŚĞĚƵůĞƐĂŶĚĚĞĂĚůŝŶĞƐ͘ŝƚǇŵĂǇƌĞƋƵŝƌĞďŝĚĚĞƌƚŽ ƉŽƐƚĂƉĞƌĨŽƌŵĂŶĐĞďŽŶĚĂĨƚĞƌĐŽŶƚƌĂĐƚĂǁĂƌĚƚŽŐƵĂƌĂŶƚĞĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞƐĞŽďůŝŐĂƚŝŽŶƐ͘ŝĚĚĞƌ ŵĂǇĞƐƚĂďůŝƐŚĂƐĞƌǀŝĐĞĐŽŶƚƌĂĐƚǁŝƚŚĂůŽĐĂůĂŐĞŶĐǇƐĂƚŝƐĨĂĐƚŽƌǇƚŽŝƚǇƚŽŵĞĞƚƚŚŝƐŽďůŝŐĂƚŝŽŶŝĨďŝĚĚĞƌ ĚŽĞƐŶŽƚŽƌĚŝŶĂƌŝůǇƉƌŽǀŝĚĞǁĂƌƌĂŶƚǇƐĞƌǀŝĐĞ͘ ϭϱ͘ĚĚĞŶĚĂ dŚĞĞĨĨĞĐƚŽĨĂůůĂĚĚĞŶĚĂƚŽƚŚĞďŝĚĚŽĐƵŵĞŶƚƐƐŚĂůůďĞĐŽŶƐŝĚĞƌĞĚŝŶƚŚĞďŝĚĂŶĚƐĂŝĚĂĚĚĞŶĚĂƐŚĂůůďĞŵĂĚĞ ƉĂƌƚŽĨƚŚĞďŝĚĚŽĐƵŵĞŶƚƐĂŶĚƐŚĂůůďĞƌĞƚƵƌŶĞĚǁŝƚŚƚŚĞŵ͘ĞĨŽƌĞƐƵďŵŝƚƚŝŶŐĂďŝĚ͕ĞĂĐŚďŝĚĚĞƌƐŚĂůůĂƐĐĞƌƚĂŝŶ ǁŚĞƚŚĞƌŽƌŶŽƚĂŶǇĂĚĚĞŶĚĂŚĂǀĞďĞĞŶŝƐƐƵĞĚ͕ĂŶĚĨĂŝůƵƌĞƚŽĐŽǀĞƌŝŶƚŚŝƐďŝĚĂŶǇƐƵĐŚĂĚĚĞŶĚĂŝƐƐƵĞĚŵĂǇ ƌĞŶĚĞƌƚŚĞďŝĚŝŶǀĂůŝĚĂŶĚƌĞƐƵůƚŝŶŝƚƐƌĞũĞĐƚŝŽŶ͘ ϭϲ͘^ƉĞĐŝĨŝĐĂƚŝŽŶƐƚŽWƌĞǀĂŝů dŚĞĚĞƚĂŝůĞĚƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐƐŚĂůůƐƵƉĞƌƐĞĚĞĂŶǇĐŽŶĨůŝĐƚŝŶŐƌĞĨĞƌĞŶĐĞŝŶƚŚĞƐĞ'ĞŶĞƌĂů WƌŽǀŝƐŝŽŶƐƚŚĂƚĂƌĞŝŶĐŽŶĨůŝĐƚƚŚĞƌĞǁŝƚŚ͘ ϭϳ͘dĂǆĞƐ dŚĞŝƚǇǁŝůůĨƵƌŶŝƐŚǆĞŵƉƚŝŽŶĞƌƚŝĨŝĐĂƚĞƐĨŽƌ&ĞĚĞƌĂůǆĐŝƐĞdĂǆ͘dŚĞŝƚǇŝƐůŝĂďůĞĨŽƌ^ƚĂƚĞ͕ŝƚǇĂŶĚŽƵŶƚǇ ^ĂůĞƐdĂǆĞƐ͘ŽŶŽƚŝŶĐůƵĚĞƚŚŝƐƚĂǆŝŶƚŚĞĂŵŽƵŶƚďŝĚ͘,ŽǁĞǀĞƌ͕ƚĂǆŝƐƚŽďĞĂĚĚĞĚďǇƚŚĞƐƵĐĐĞƐƐĨƵůďŝĚĚĞƌƚŽ ƚŚĞŶĞƚĂŵŽƵŶƚŝŶǀŽŝĐĞĚ͘ůůŽƌĂŶǇƉŽƌƚŝŽŶŽĨƚŚĞŝƚǇ^ĂůĞƐdĂǆƌĞƚƵƌŶĞĚƚŽƚŚĞŝƚǇǁŝůůďĞĐŽŶƐŝĚĞƌĞĚŝŶƚŚĞ ĞǀĂůƵĂƚŝŽŶŽĨďŝĚƐ͘ ϭϴ͘ŽŶĨůŝĐƚŽĨ/ŶƚĞƌĞƐƚ EŽ ŝƚǇ ĞŵƉůŽǇĞĞ Žƌ ĞůĞĐƚĞĚ Žƌ ĂƉƉŽŝŶƚĞĚ ŵĞŵďĞƌ ŽĨ ŝƚǇ ŐŽǀĞƌŶŵĞŶƚ͕ Žƌ ŵĞŵďĞƌ ŽĨ ƚŚĞ ĞŵƉůŽǇĞĞ͛Ɛ ŝŵŵĞĚŝĂƚĞĨĂŵŝůǇ͕ŵĂǇƉĂƌƚŝĐŝƉĂƚĞĚŝƌĞĐƚůǇŽƌŝŶĚŝƌĞĐƚůǇŝŶƚŚĞƉƌŽĐƵƌĞŵĞŶƚƉƌŽĐĞƐƐƉĞƌƚĂŝŶŝŶŐƚŽƚŚŝƐďŝĚŝĨƚŚĞǇ͗ ĂͿ,ĂǀĞĂĨŝŶĂŶĐŝĂůŝŶƚĞƌĞƐƚŽƌŽƚŚĞƌƉĞƌƐŽŶĂůŝŶƚĞƌĞƐƚƚŚĂƚŝƐŝŶĐŽŵƉĂƚŝďůĞǁŝƚŚƚŚĞƉƌŽƉĞƌĚŝƐĐŚĂƌŐĞŽĨƚŚĞŝƌ ŽĨĨŝĐŝĂůĚƵƚŝĞƐŝŶƚŚĞƉƵďůŝĐŝŶƚĞƌĞƐƚŽƌǁŽƵůĚƚĞŶĚƚŽŝŵƉĂŝƌƚŚĞŝƌŝŶĚĞƉĞŶĚĞŶĐĞ͕ũƵĚŐŵĞŶƚŽƌĂĐƚŝŽŶŝŶ ƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞŝƌŽĨĨŝĐŝĂůĚƵƚŝĞƐ͘ Page 491 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϭͮWĂŐĞ ďͿƌĞŶĞŐŽƚŝĂƚŝŶŐĨŽƌŽƌŚĂǀĞĂŶĂƌƌĂŶŐĞŵĞŶƚĐŽŶĐĞƌŶŝŶŐƉƌŽƐƉĞĐƚŝǀĞĞŵƉůŽǇŵĞŶƚǁŝƚŚďŝĚĚĞƌ͘dŚĞďŝĚĚĞƌ ǁĂƌƌĂŶƚƐƚŽƚŚĞďĞƐƚŽĨŚŝƐŬŶŽǁůĞĚŐĞƚŚĂƚƚŚĞƐƵďŵŝƐƐŝŽŶŽĨƚŚĞďŝĚǁŝůůŶŽƚĐƌĞĂƚĞƐƵĐŚĐŽŶĨůŝĐƚŽĨ ŝŶƚĞƌĞƐƚ͘/ŶƚŚĞĞǀĞŶƚƐƵĐŚĂĐŽŶĨůŝĐƚŽĐĐƵƌƐ͕ƚŚĞďŝĚĚĞƌŝƐƚŽƌĞƉŽƌƚŝƚŝŵŵĞĚŝĂƚĞůǇƚŽƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚ͘ &ŽƌďƌĞĂĐŚŽƌǀŝŽůĂƚŝŽŶŽĨƚŚŝƐǁĂƌƌĂŶƚǇ͕ƚŚĞŝƚǇƐŚĂůůŚĂǀĞƚŚĞƌŝŐŚƚƚŽĂŶŶƵůƚŚŝƐĐŽŶƚƌĂĐƚǁŝƚŚŽƵƚůŝĂďŝůŝƚǇ ĂƚŝƚƐĚŝƐĐƌĞƚŝŽŶ͕ĂŶĚďŝĚĚĞƌŵĂǇďĞƐƵďũĞĐƚƚŽĚĂŵĂŐĞƐĂŶĚͬŽƌĚĞďĂƌŵĞŶƚŽƌƐƵƐƉĞŶƐŝŽŶ͘ ϭϵ͘'ƌĂƚƵŝƚŝĞƐ dŚĞŝƚǇŵĂǇƌĞƐĐŝŶĚƚŚĞƌŝŐŚƚŽĨƚŚĞďŝĚĚĞƌƚŽƉƌŽĐĞĞĚƵŶĚĞƌƚŚŝƐĂŐƌĞĞŵĞŶƚŝĨŝƚŝƐĨŽƵŶĚƚŚĂƚŐƌĂƚƵŝƚŝĞƐŝŶƚŚĞ ĨŽƌŵŽĨĞŶƚĞƌƚĂŝŶŵĞŶƚ͕ŐŝĨƚƐ͕ŽƌŽƚŚĞƌǁŝƐĞĂƌĞŽĨĨĞƌĞĚŽƌŐŝǀĞŶďǇƚŚĞďŝĚĚĞƌ͕ŽƌĂŶǇĂŐĞŶƚŽƌƌĞƉƌĞƐĞŶƚĂƚŝǀĞŽĨ ƚŚĞďŝĚĚĞƌ͕ƚŽĂŶǇŽĨĨŝĐĞƌŽƌĞŵƉůŽǇĞĞŽĨƚŚĞŝƚǇǁŝƚŚƚŚĞŝŶƚĞŶƚŽĨŝŶĨůƵĞŶĐŝŶŐĂǁĂƌĚŽĨƚŚŝƐĂŐƌĞĞŵĞŶƚŽƌ ƐĞĐƵƌŝŶŐĨĂǀŽƌĂďůĞƚƌĞĂƚŵĞŶƚǁŝƚŚƌĞƐƉĞĐƚƚŽƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚŝƐĂŐƌĞĞŵĞŶƚ͘ ϮϬ͘&ĂŝƚŚĨƵůWĞƌĨŽƌŵĂŶĐĞŽŶĚ ^ƵĐĐĞƐƐĨƵů ďŝĚĚĞƌ ŵĂǇ ďĞ ƌĞƋƵŝƌĞĚ ƚŽ ĨƵƌŶŝƐŚ ƚŚĞ ŝƚǇ ǁŝƚŚ Ă ƐƵƌĞƚǇďŽŶĚĐŽŶĚŝƚŝŽŶĞĚƵƉŽŶƚŚĞĨĂŝƚŚĨƵů ƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞĐŽŶƚƌĂĐƚ͘dŚŝƐŵĂǇƚĂŬĞƚŚĞĨŽƌŵŽĨĂďŽŶĚĞǆĞĐƵƚĞĚďǇĂƐƵƌĞƚǇĐŽŵƉĂŶǇĂƵƚŚŽƌŝǌĞĚƚŽĚŽ ďƵƐŝŶĞƐƐŝŶƚŚĞ^ƚĂƚĞŽĨĂůŝĨŽƌŶŝĂĂŶĚĂƉƉƌŽǀĞĚďǇƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂ͕ĂŶĞŶĚŽƌƐĞĚĞƌƚŝĨŝĐĂƚĞŽĨĞƉŽƐŝƚ͕ ŽƌĂŵŽŶĞǇŽƌĚĞƌŽƌĂĐĞƌƚŝĨŝĞĚĐŚĞĐŬĚƌĂǁŶŽŶĂƐŽůǀĞŶƚďĂŶŬ͘dŚĞďŽŶĚƐŚĂůůďĞŝŶĂƐƵŵĞƋƵĂůƚŽŽŶĞŚƵŶĚƌĞĚ ƉĞƌĐĞŶƚ;ϭϬϬйͿŽĨƚŚĞĂŵŽƵŶƚŽĨƚŚĞĐŽŶƚƌĂĐƚƉƌŝĐĞ͘^ƵĐŚďŽŶĚŽƌĚĞƉŽƐŝƚƐŚĂůůďĞĨŽƌĨĞŝƚĞĚƚŽƚŚĞŝƚǇŝŶƚŚĞ ĞǀĞŶƚ ƚŚĂƚ ďŝĚĚĞƌ ƌĞĐĞŝǀŝŶŐ ƚŚĞĐŽŶƚƌĂĐƚ ƐŚĂůů ĨĂŝů Žƌ ƌĞĨƵƐĞ ƚŽ ĨƵůĨŝůů ƚŚĞ ƌĞƋƵŝƌĞŵĞŶƚƐ ĂŶĚ Ăůů ƚĞƌŵƐ ĂŶĚ ĐŽŶĚŝƚŝŽŶƐŽĨƚŚĞĐŽŶƚƌĂĐƚ͘ Ϯϭ͘/ŶƐƵƌĂŶĐĞ ŝĚĚĞƌƐŚĂůůƉƌŽǀŝĚĞƉƌŽŽĨŽĨůŝĂďŝůŝƚǇĂŶĚƉƌŽƉĞƌƚǇĚĂŵĂŐĞŝŶƐƵƌĂŶĐĞƉƌŝŽƌƚŽƉĞƌĨŽƌŵĂŶĐĞŽĨĚƵƚŝĞƐ͘ŽǀĞƌĂŐĞ ƐŚĂůůďĞĨƌŽŵĂĐŽŵƉĂŶǇĂƵƚŚŽƌŝǌĞĚƚŽƚƌĂŶƐĂĐƚďƵƐŝŶĞƐƐŝŶƚŚĞ^ƚĂƚĞŽĨĂůŝĨŽƌŶŝĂĂŶĚƐŚĂůůďĞŝŶĂŶĂŵŽƵŶƚŶŽƚ ůĞƐƐƚŚĂŶΨϭ͕ϬϬϬ͕ϬϬϬĐŽŵďŝŶĞĚƐŝŶŐůĞůŝŵŝƚ;^>Ϳ͕ƵŶůĞƐƐŽƚŚĞƌǁŝƐĞƐƉĞĐŝĨŝĞĚ͘dŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂƐŚĂůůďĞ ŶĂŵĞĚ ĂƐ ĂŶ ĂĚĚŝƚŝŽŶĂů ŝŶƐƵƌĞĚ ĂŶĚ ƚŚŝƌƚǇ ;ϯϬͿ ĚĂǇƐ͛ ŶŽƚŝĐĞ ŽĨĐĂŶĐĞůůĂƚŝŽŶ ƐŚĂůů ďĞŝŶĚŝĐĂƚĞĚ͘ tŽƌŬĞƌ͛Ɛ ŽŵƉĞŶƐĂƚŝŽŶĐŽǀĞƌĂŐĞĨŽƌĞĂĐŚĞŵƉůŽǇĞĞĞŶŐĂŐĞĚŝŶǁŽƌŬŽŶŝƚǇƉƌĞŵŝƐĞƐŝƐƌĞƋƵŝƌĞĚ͘ŝĚĚĞƌŝƐƐŽůĞůǇ ƌĞƐƉŽŶƐŝďůĞĨŽƌĂůůŝŶƐƵƌĂŶĐĞƉƌĞŵŝƵŵƉĂǇŵĞŶƚƐ͘ ϮϮ͘/ŶĚĞŵŶŝĨŝĐĂƚŝŽŶ ŝĚĚĞƌ ƐŚĂůů ĚĞĨĞŶĚ͕ ŝŶĚĞŵŶŝĨǇ͕ ƉƌŽƚĞĐƚ ĂŶĚ ŚŽůĚ ŚĂƌŵůĞƐƐ ƚŚĞ ŝƚǇ͕ŝƚƐĞůĞĐƚĞĚĂŶĚĂƉƉŽŝŶƚĞĚŽĨĨŝĐĞƌƐ͕ ĞŵƉůŽǇĞĞƐ͕ĂŶĚĂŐĞŶƚƐ͕ĨƌŽŵĂŶĚĂŐĂŝŶƐƚĂůůĐůĂŝŵƐĨŽƌĚĂŵĂŐĞƐ͕ůŝĂďŝůŝƚǇ͕ĂŶĚĞǆƉĞŶƐĞƐ;ŝŶĐůƵĚŝŶŐĂƚƚŽƌŶĞǇ͛Ɛ ĨĞĞƐͿĂƌŝƐŝŶŐŽƵƚŽĨƚŚŝƐĂŐƌĞĞŵĞŶƚĂŶĚͬŽƌďŝĚĚĞƌ͛ƐƉĞƌĨŽƌŵĂŶĐĞŚĞƌĞƵŶĚĞƌ͕ĞǆĐĞƉƚĂƐƚŽƐƵĐŚĚĂŵĂŐĞƐ͕ůŝĂďŝůŝƚǇ͕ ĂŶĚĞǆƉĞŶƐĞƐĚƵĞƚŽƚŚĞƐŽůĞŶĞŐůŝŐĞŶĐĞŽƌǁŝůůĨƵůĂĐƚƐŽĨƚŚĞŝƚǇ͕ŝƚƐŽĨĨŝĐĞƌƐ͕ĞŵƉůŽǇĞĞƐŽƌĂŐĞŶƚƐ͘ Ϯϯ͘ǁĂƌĚŽĨŽŶƚƌĂĐƚ ĂͿŝĚƐǁŝůůďĞĂŶĂůǇǌĞĚ͕ĂŶĚĂǁĂƌĚǁŝůůďĞŵĂĚĞƚŽƚŚĞůŽǁĞƐƚ͕ƌĞƐƉŽŶƐŝǀĞĂŶĚƌĞƐƉŽŶƐŝďůĞďŝĚĚĞƌǁŚŽƐĞďŝĚ ĐŽŶĨŽƌŵƐƚŽƚŚĞƐŽůŝĐŝƚĂƚŝŽŶĂŶĚǁŚŽƐĞďŝĚŝƐĐŽŶƐŝĚĞƌĞĚƚŽďĞŵŽƐƚĂĚǀĂŶƚĂŐĞŽƵƐƚŽƚŚĞŝƚǇ͕ƉƌŝĐĞĂŶĚ ŽƚŚĞƌĨĂĐƚŽƌƐĐŽŶƐŝĚĞƌĞĚ͘&ĂĐƚŽƌƐƚŽďĞĐŽŶƐŝĚĞƌĞĚŵĂǇŝŶĐůƵĚĞ͕ďƵƚĂƌĞŶŽƚůŝŵŝƚĞĚƚŽ͗ďŝĚĚĞƌ͛ƐƉĂƐƚ ƉĞƌĨŽƌŵĂŶĐĞ͕ƚŽƚĂůƵŶŝƚĐŽƐƚ͕ĞĐŽŶŽŵŝĐĐŽƐƚĂŶĂůǇƐŝƐ͕ůŝĨĞĐǇĐůĞĐŽƐƚƐ͕ǁĂƌƌĂŶƚǇĂŶĚƋƵĂůŝƚǇ͕ŵĂŝŶƚĞŶĂŶĐĞ ĐŽƐƚ͕ĚƵƌĂďŝůŝƚǇ͕ƚŚĞŽƉĞƌĂƚŝŽŶĂůƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞŝƚǇĂŶĚĂŶǇŽƚŚĞƌĨĂĐƚŽƌƐǁŚŝĐŚǁŝůůƌĞƐƵůƚŝŶƚŚĞ ŽƉƚŝŵƵŵĞĐŽŶŽŵŝĐďĞŶĞĨŝƚƚŽƚŚĞŝƚǇ͘ ďͿdŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƌĞũĞĐƚĂŶǇŝƚĞŵŽƌŝƚĞŵƐ͕ƚŽǁĂŝǀĞŝŶĨŽƌŵĂůŝƚŝĞƐ͕ƚĞĐŚŶŝĐĂůĚĞĨĞĐƚƐĂŶĚŵŝŶŽƌ ŝƌƌĞŐƵůĂƌŝƚŝĞƐŝŶďŝĚƐƌĞĐĞŝǀĞĚ͖ĂŶĚƚŽƐĞůĞĐƚƚŚĞďŝĚ;ƐͿĚĞĞŵĞĚŵŽƐƚĂĚǀĂŶƚĂŐĞŽƵƐƚŽƚŚĞŝƚǇ͘dŚĞŝƚǇ ǁŝůů͕ŚŽǁĞǀĞƌ͕ĐŽŶƐŝĚĞƌďŝĚƐƐƵďŵŝƚƚĞĚŽŶĂŶ͞ĂůůŽƌŶŽƚŚŝŶŐ͟ďĂƐŝƐŝĨƚŚĞďŝĚŝƐĐůĞĂƌůǇĚĞƐŝŐŶĂƚĞĚĂƐƐƵĐŚ͘ ĐͿdŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽĂǁĂƌĚŽŶĞŽƌŵŽƌĞĐŽŶƚƌĂĐƚƐŽŶƚŚĞďŝĚƐƐƵďŵŝƚƚĞĚ͕ĞŝƚŚĞƌďǇĂǁĂƌĚŽĨĂůů ŝƚĞŵƐƚŽŽŶĞďŝĚĚĞƌŽƌďǇĂǁĂƌĚŽĨƐĞƉĂƌĂƚĞŝƚĞŵƐŽƌŐƌŽƵƉƐŽĨŝƚĞŵƐƚŽǀĂƌŝŽƵƐďŝĚĚĞƌƐĂƐƚŚĞŝŶƚĞƌĞƐƚƐ ŽĨƚŚĞŝƚǇŵĂǇƌĞƋƵŝƌĞ͕ƵŶůĞƐƐƚŚĞďŝĚĚĞƌĐůĞĂƌůǇƐƉĞĐŝĨŝĞƐŽƚŚĞƌǁŝƐĞŝŶŚŝƐďŝĚ͘ Page 492 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϮͮWĂŐĞ ĚͿ&ŽƌƚŚĞƉƵƌƉŽƐĞŽĨĞǀĂůƵĂƚŝŶŐďŝĚƐĨŽƌŵƵůƚŝƉůĞĂǁĂƌĚƐ͕ƚŚĞƐƵŵŽĨΨϭϬϬ͘ϬϬŝƐĐŽŶƐŝĚĞƌĞĚƚŽďĞƚŚĞ ĂĚŵŝŶŝƐƚƌĂƚŝǀĞĐŽƐƚƚŽƚŚĞŝƚǇĨŽƌŝƐƐƵŝŶŐĂŶĚĂĚŵŝŶŝƐƚĞƌŝŶŐĞĂĐŚĐŽŶƚƌĂĐƚĂǁĂƌĚĞĚƵŶĚĞƌƚŚŝƐƐŽůŝĐŝƚĂƚŝŽŶ͕ ĂŶĚŝŶĚŝǀŝĚƵĂůĂǁĂƌĚƐǁŝůůďĞŵĂĚĞĨŽƌƚŚĞŝƚĞŵƐĂŶĚĐŽŵďŝŶĂƚŝŽŶƐŽĨŝƚĞŵƐǁŚŝĐŚƌĞƐƵůƚŝŶƚŚĞůŽǁĞƐƚ ĂŐŐƌĞŐĂƚĞƉƌŝĐĞƚŽƚŚĞŝƚǇ͕ŝŶĐůƵĚŝŶŐƐƵĐŚĂĚŵŝŶŝƐƚƌĂƚŝǀĞĐŽƐƚ͘ ĞͿhƉŽŶĂĐĐĞƉƚĂŶĐĞďǇƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂ͕ƚŚĞƐŽůŝĐŝƚĂƚŝŽŶ͕ďŝĚ͕ƉƌŽƉŽƐĂů͕ŽƌƉƌŝĐĞƋƵŽƚĂƚŝŽŶĂŶĚĂ ƉƵƌĐŚĂƐĞ ŽƌĚĞƌ ŝƐƐƵĞĚ ƚŽ ƚŚĞ ƐƵĐĐĞƐƐĨƵů ďŝĚĚĞƌ ƐŚĂůů ďĞ ĚĞĞŵĞĚƚŽƌĞƐƵůƚŝŶĂďŝŶĚŝŶŐĐŽŶƚƌĂĐƚ ŝŶĐŽƌƉŽƌĂƚŝŶŐƚŚŽƐĞƚĞƌŵƐĂŶĚƚŚĞƐĞ'ĞŶĞƌĂůWƌŽǀŝƐŝŽŶƐǁŝƚŚŽƵƚĨƵƌƚŚĞƌĂĐƚŝŽŶƌĞƋƵŝƌĞĚďǇĞŝƚŚĞƌƉĂƌƚǇ͘ /ƚĞŵƐĂƌĞƚŽďĞĨƵƌŶŝƐŚĞĚĂƐĚĞƐĐƌŝďĞĚŝŶƚŚĞďŝĚĂŶĚŝŶƐƚƌŝĐƚĐŽŶĨŽƌŵŝƚǇǁŝƚŚĂůůŝŶƐƚƌƵĐƚŝŽŶƐ͕ĐŽŶĚŝƚŝŽŶƐ͕ ƐƉĞĐŝĨŝĐĂƚŝŽŶƐ͕ĂŶĚƉƌŽǀŝƐŝŽŶƐŝŶƚŚĞĐŽŵƉůĞƚĞĐŽŶƚƌĂĐƚ͕ĂƐĚĞĨŝŶĞĚďǇƚŚŝƐĐůĂƵƐĞϮϴŽƌĂŶǇƌĞůĂƚĞĚ ŝŶƚĞŐƌĂƚĞĚĂŐƌĞĞŵĞŶƚ͘ Ϯϰ͘WƌŽƚĞƐƚƐ WƌŽƚĞƐƚƐďǇƵŶƐƵĐĐĞƐƐĨƵůďŝĚĚĞƌƐƚŽƚŚĞƐĞůĞĐƚŝŽŶĨŽƌĂǁĂƌĚƐŚĂůůďĞƐƵďŵŝƚƚĞĚŝŶǁƌŝƚŝŶŐƚŽƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚ ŶŽůĂƚĞƌƚŚĂŶƚĞŶ;ϭϬͿĐĂůĞŶĚĂƌĚĂǇƐĂĨƚĞƌĂǁĂƌĚƌĞĐŽŵŵĞŶĚĂƚŝŽŶ͘dŚĞƵŶƐƵĐĐĞƐƐĨƵůďŝĚĚĞƌƐŚĂůůŚĂǀĞƚŚĞƌŝŐŚƚ ƚŽĂƉƉĞĂƌĂƚƚŚĞŝƚǇŽƵŶĐŝůƚŽƉƌŽƚĞƐƚĂŶǇĂǁĂƌĚƚŽďĞĐŽŶĨŝƌŵĞĚďǇŽƵŶĐŝů͘&ĂŝůƵƌĞƚŽƐƵďŵŝƚĂƚŝŵĞůǇǁƌŝƚƚĞŶ ƉƌŽƚĞƐƚƚŽƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚƐŚĂůůďĂƌĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƐƵĐŚƉƌŽƚĞƐƚ͘ Ϯϱ͘ŽĐƵŵĞŶƚĂƚŝŽŶ ƵĞƚŽƚŚĞƚŝŵĞĐŽŶƐƚƌĂŝŶƚƐƚŚĂƚĂĨĨĞĐƚĐŽŶƚƌĂĐƚƉĞƌĨŽƌŵĂŶĐĞ͕ĂůůƌĞƋƵŝƌĞĚĚŽĐƵŵĞŶƚƐ͕ĐĞƌƚŝĨŝĐĂƚĞƐŽĨŝŶƐƵƌĂŶĐĞ ĂŶĚďŽŶĚƐƐŚĂůůďĞƉƌŽǀŝĚĞĚƚŽƚŚĞŝƚǇǁŝƚŚŝŶƚĞŶ;ϭϬͿĐĂůĞŶĚĂƌĚĂǇƐĨŽůůŽǁŝŶŐĂǁĂƌĚŽƌĚĂƚĞŽĨƌĞƋƵĞƐƚďǇŝƚǇ͕ ǁŚŝĐŚĞǀĞƌŝƐůĂƚĞƌ͘ŶǇĨĂŝůƵƌĞƚŽĐŽŵƉůǇŵĂǇƌĞƐƵůƚŝŶďŝĚďĞŝŶŐĚĞĐůĂƌĞĚŶŽŶͲƌĞƐƉŽŶƐŝǀĞĂŶĚƌĞũĞĐƚĞĚ͕ĂŶĚĂƚ ŝƚǇ͛ƐŽƉƚŝŽŶƚŚĞďŝĚďŽŶĚŵĂǇďĞĂƚƚĂĐŚĞĚĨŽƌĚĂŵĂŐĞƐƐƵĨĨĞƌĞĚ͘ Ϯϲ͘^ĞůůĞƌ͛Ɛ/ŶǀŽŝĐĞ /ŶǀŽŝĐĞƐƐŚĂůůďĞƉƌĞƉĂƌĞĚĂŶĚƐƵďŵŝƚƚĞĚŝŶĚƵƉůŝĐĂƚĞƚŽĂĚĚƌĞƐƐƐŚŽǁŶŽŶƚŚĞWƵƌĐŚĂƐĞKƌĚĞƌ͘^ĞƉĂƌĂƚĞ ŝŶǀŽŝĐĞƐĂƌĞƌĞƋƵŝƌĞĚĨŽƌĞĂĐŚWƵƌĐŚĂƐĞKƌĚĞƌ͘/ŶǀŽŝĐĞƐƐŚĂůůĐŽŶƚĂŝŶƚŚĞĨŽůůŽǁŝŶŐŝŶĨŽƌŵĂƚŝŽŶ͗WƵƌĐŚĂƐĞKƌĚĞƌ ŶƵŵďĞƌ͕ŝƚĞŵŶƵŵďĞƌ͕ĚĞƐĐƌŝƉƚŝŽŶŽĨƐƵƉƉůŝĞƐŽƌƐĞƌǀŝĐĞƐ͕ƐŝǌĞƐ͕ƵŶŝƚŽĨŵĞĂƐƵƌĞ͕ƋƵĂŶƚŝƚǇ͕ƵŶŝƚƉƌŝĐĞĂŶĚ ĞǆƚĞŶĚĞĚƚŽƚĂůƐ͘ Ϯϳ͘ŽĐƵŵĞŶƚKǁŶĞƌƐŚŝƉ ĂͿůůƚĞĐŚŶŝĐĂůĚŽĐƵŵĞŶƚƐĂŶĚƌĞĐŽƌĚƐŽƌŝŐŝŶĂƚĞĚŽƌƉƌĞƉĂƌĞĚƉƵƌƐƵĂŶƚƚŽƚŚŝƐĐŽŶƚƌĂĐƚ͕ŝŶĐůƵĚŝŶŐƉĂƉĞƌƐ͕ ƌĞƉŽƌƚƐ͕ĐŚĂƌƚƐ͕ĂŶĚĐŽŵƉƵƚĞƌƉƌŽŐƌĂŵƐ͕ƐŚĂůůďĞĚĞůŝǀĞƌĞĚƚŽĂŶĚďĞĐŽŵĞƚŚĞĞǆĐůƵƐŝǀĞƉƌŽƉĞƌƚǇŽĨƚŚĞ ŝƚǇĂŶĚŵĂǇďĞĐŽƉǇƌŝŐŚƚĞĚďǇƚŚĞŝƚǇ͘ŝĚĚĞƌĂƐƐŝŐŶƐĂůůĐŽƉǇƌŝŐŚƚƐƚŽŝƚǇďǇƵŶĚĞƌƚĂŬŝŶŐƚŚŝƐ ĂŐƌĞĞŵĞŶƚ ďͿůůŝŶǀĞŶƚŝŽŶƐ͕ĚŝƐĐŽǀĞƌŝĞƐ͕ĞŶŚĂŶĐĞŵĞŶƚƐ͕ĐŚĂŶŐĞƐ͕ŽƌŝŵƉƌŽǀĞŵĞŶƚƐŽĨĐŽŵƉƵƚĞƌƉƌŽŐƌĂŵƐĚĞǀĞůŽƉĞĚ ƉƵƌƐƵĂŶƚƚŽƚŚŝƐĐŽŶƚƌĂĐƚƐŚĂůůďĞƚŚĞƉƌŽƉĞƌƚǇŽĨƚŚĞŝƚǇ͕ĂŶĚĂůůƉĂƚĞŶƚƐŽƌĐŽƉǇƌŝŐŚƚƐƐŚĂůůďĞĂƐƐŝŐŶĞĚ ƚŽŝƚǇ͕ƵŶůĞƐƐŽƚŚĞƌǁŝƐĞĂŐƌĞĞĚ͘ŝĚĚĞƌĂŐƌĞĞƐƚŚĂƚŝƚǇŵĂǇŵĂŬĞŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽĐŽŵƉƵƚĞƌƐŽĨƚǁĂƌĞ ĨƵƌŶŝƐŚĞĚďǇďŝĚĚĞƌǁŝƚŚŽƵƚŝŶĨƌŝŶŐŝŶŐďŝĚĚĞƌ͛ƐĐŽƉǇƌŝŐŚƚŽƌĂŶǇůŝĐĞŶƐĞŐƌĂŶƚĞĚƚŽŝƚǇ͘ Ϯϴ͘ĚǀĞƌƚŝƐĞŵĞŶƚƐ͕WƌŽĚƵĐƚŶĚŽƌƐĞŵĞŶƚƐ ŝƚǇĞŵƉůŽǇĞĞƐĂŶĚĂŐĞŶĐŝĞƐŽƌŽƌŐĂŶŝǌĂƚŝŽŶƐĨƵŶĚĞĚďǇƚŚĞŝƚǇĂƌĞƉƌŽŚŝďŝƚĞĚĨƌŽŵŵĂŬŝŶŐĞŶĚŽƌƐĞŵĞŶƚƐ͕ ĞŝƚŚĞƌŝŵƉůŝĞĚŽƌĚŝƌĞĐƚ͕ŽĨĐŽŵŵĞƌĐŝĂůƉƌŽĚƵĐƚƐŽƌƐĞƌǀŝĐĞƐǁŝƚŚŽƵƚǁƌŝƚƚĞŶĂƉƉƌŽǀĂůŽĨƚŚĞŝƚǇDĂŶĂŐĞƌ͘EŽ ďŝĚĚĞƌŵĂǇƌĞƉƌĞƐĞŶƚƚŚĂƚƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŚĂƐĞŶĚŽƌƐĞĚƚŚĞŝƌƉƌŽĚƵĐƚŽƌƐĞƌǀŝĐĞǁŝƚŚŽƵƚƚŚĞWƵƌĐŚĂƐŝŶŐ ŐĞŶƚ͛ƐƉƌŝŽƌǁƌŝƚƚĞŶĂƉƉƌŽǀĂů͘ Ϯϵ͘ŝƚǇWƌŽǀŝƐŝŽŶƐƚŽWƌĞǀĂŝů Page 493 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϯͮWĂŐĞ ǆĐĞƉƚĂƐŝŶĚŝĐĂƚĞĚŝŶƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐ͕ƚŚĞŝƚǇ͛ƐƐƚĂŶĚĂƌĚ'ĞŶĞƌĂůWƌŽǀŝƐŝŽŶƐƐŚĂůůŐŽǀĞƌŶĂŶǇĐŽŶƚƌĂĐƚĂǁĂƌĚ͘ ŶǇƐƚĂŶĚĂƌĚƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐŽĨďŝĚĚĞƌƐƵďŵŝƚƚĞĚďǇďŝĚĚĞƌƐŚĂůůŶŽƚďĞĂĐĐĞƉƚĂďůĞƚŽŝƚǇƵŶůĞƐƐĞǆƉƌĞƐƐůǇ ĂŐƌĞĞĚƚŽďǇƚŚĞŝƚǇ͘dŚĞŝƚǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƌĞũĞĐƚďŝĚĚĞƌ͛ƐďŝĚĂƐŶŽŶͲƌĞƐƉŽŶƐŝǀĞ͕ƚŽĐŽŶƐŝĚĞƌƚŚĞďŝĚ ǁŝƚŚŽƵƚďŝĚĚĞƌ͛ƐƐƚĂŶĚĂƌĚƚĞƌŵƐĂŶĚĐŽŶĚŝƚŝŽŶƐ͕ŽƌƚŽƌĞƋƵŝƌĞďŝĚĚĞƌƚŽĚĞůĞƚĞƌĞĨĞƌĞŶĐĞƚŽƐƵĐŚĂƐĂĐŽŶĚŝƚŝŽŶ ŽĨĞǀĂůƵĂƚŝŽŶŽƌĂǁĂƌĚŽĨƚŚĞďŝĚ͘/Ĩ͕ĂĨƚĞƌĂǁĂƌĚŽĨĐŽŶƚƌĂĐƚ͕ďŝĚĚĞƌ;ĐŽŶƚƌĂĐƚǀĞŶĚŽƌͿƐŚĂůůƉƌŽǀŝĚĞŵĂƚĞƌŝĂůƐ ŽƌƐĞƌǀŝĐĞƐĂĐĐŽŵƉĂŶŝĞĚďǇŶĞǁŽƌĂĚĚŝƚŝŽŶĂůƐƚĂŶĚĂƌĚƚĞƌŵƐŽƌĐŽŶĚŝƚŝŽŶƐ͕ƚŚĞǇƚŽŽƐŚĂůůďĞĐŽŶƐŝĚĞƌĞĚǀŽŝĚ ĂŶĚŝƚǇŵĂǇƌĞƋƵŝƌĞĚĞůĞƚŝŽŶĂƐĂĨƵƌƚŚĞƌĐŽŶĚŝƚŝŽŶŽĨƉĞƌĨŽƌŵĂŶĐĞďǇŝĚĚĞƌ͘dŽƚŚĞĞǆƚĞŶƚŶŽƚŽƚŚĞƌǁŝƐĞ ƉƌŽǀŝĚĞĚĨŽƌďǇƚŚĞĐŽŶƚƌĂĐƚĚŽĐƵŵĞŶƚƐ͕ƚŚĞĂůŝĨŽƌŶŝĂŽŵŵĞƌĐŝĂůŽĚĞƐŚĂůůĂƉƉůǇ͘ ϯϬ͘/ŶǀĂůŝĚWƌŽǀŝƐŝŽŶƐ /ŶƚŚĞĞǀĞŶƚƚŚĂƚĂŶǇŽŶĞŽƌŵŽƌĞŽĨƚŚĞƉƌŽǀŝƐŝŽŶƐŽĨƚŚŝƐĂŐƌĞĞŵĞŶƚƐŚĂůůďĞĨŽƵŶĚƚŽďĞŝŶǀĂůŝĚ͕ŝůůĞŐĂůŽƌ ƵŶĞŶĨŽƌĐĞĂďůĞ͕ƚŚĞƌĞŵĂŝŶŝŶŐƉƌŽǀŝƐŝŽŶƐƐŚĂůůƌĞŵĂŝŶŝŶĞĨĨĞĐƚĂŶĚďĞĞŶĨŽƌĐĞĂďůĞ͘ ϯϭ͘ŵĞŶĚŵĞŶƚƐĂŶĚDŽĚŝĨŝĐĂƚŝŽŶƐ dŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚŵĂǇĂƚĂŶǇƚŝŵĞ͕ďǇǁƌŝƚƚĞŶŽƌĚĞƌ͕ĂŶĚǁŝƚ ŚŽƵƚŶŽƚŝĐĞƚŽƚŚĞƐƵƌĞƚŝĞƐ͕ŵĂŬĞĂŵŽĚŝĨŝĐĂƚŝŽŶ ƚŽƚŚĞĐŽŶƚƌĂĐƚŽƌĂŶĂŵĞŶĚŵĞŶƚƚŽƚŚĞWƵƌĐŚĂƐĞKƌĚĞƌ͕ǁŝƚŚŝŶƚŚĞŐĞŶĞƌĂůƐĐŽƉĞŽĨƚŚŝƐĐŽŶƚƌĂĐƚ͕ŝŶ;ϭͿƋƵĂŶƚŝƚǇ ŽĨŵĂƚĞƌŝĂůƐŽƌƐĞƌǀŝĐĞ͕ǁŚĞƚŚĞƌŵŽƌĞŽƌůĞƐƐ͖;ϮͿĚƌĂǁŝŶŐƐ͕ĚĞƐŝŐŶƐ͕ŽƌƐƉĞĐŝĨŝĐĂƚŝŽŶƐ͕ǁŚĞƌĞƚŚĞƐƵƉƉůŝĞƐƚŽďĞ ĨƵƌŶŝƐŚĞĚĂƌĞƚŽďĞƐƉĞĐŝĂůůǇŵĂŶƵĨĂĐƚƵƌĞĚĨŽƌƚŚĞŝƚǇ͖;ϯͿŵĞƚŚŽĚŽĨƐŚŝƉŵĞŶƚŽƌƉĂĐŬŝŶŐ͖ĂŶĚ;ϰͿƉůĂĐĞŽĨ ĚĞůŝǀĞƌǇ͘/ĨĂŶǇƐƵĐŚĐŚĂŶŐĞĐĂƵƐĞƐĂŶŝŶĐƌĞĂƐĞŽƌĚĞĐƌĞĂƐĞŝŶƚŚĞĐŽƐƚŽƌƚŚĞƚŝŵĞƌĞƋƵŝƌĞĚĨŽƌƚŚĞƉĞƌĨŽƌŵĂŶĐĞ ŽĨƚŚŝƐĐŽŶƚƌĂĐƚ͕ĂŶĞƋƵŝƚĂďůĞĂĚũƵƐƚŵĞŶƚƐŚĂůůďĞŵĂĚĞďǇǁƌŝƚƚĞŶŵŽĚŝĨŝĐĂƚŝŽŶŽĨƚŚĞĐŽŶƚƌĂĐƚŽƌĂŵĞŶĚŵĞŶƚ ƚŽƚŚĞWƵƌĐŚĂƐĞKƌĚĞƌ͘ŶǇĐůĂŝŵďǇƚŚĞďŝĚĚĞƌĨŽƌĂĚũƵƐƚŵĞŶƚƵŶĚĞƌƚŚŝƐĐůĂƵƐĞŵƵƐƚďĞĂƐƐĞƌƚĞĚǁŝƚŚŝŶϯϬ ĐĂůĞŶĚĂƌĚĂǇƐĨƌŽŵƚŚĞŶŽƚŝĨŝĐĂƚŝŽŶĚĂƚĞ͘ ϯϮ͘ƐƐŝŐŶŵĞŶƚ ŝĚĚĞƌƐŚĂůůŶŽƚĂƐƐŝŐŶŽƌĚĞůĞŐĂƚĞĚƵƚŝĞƐŽƌƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐƵŶĚĞƌƚŚŝƐĂŐƌĞĞŵĞŶƚ͕ŝŶǁŚŽůĞŽƌŝŶƉĂƌƚ͕ǁŝƚŚŽƵƚ ƉƌŝŽƌǁƌŝƚƚĞŶĂƉƉƌŽǀĂůŽĨƚŚĞŝƚǇ͘ ϯϯ͘ŝƐƉƵƚĞƐ ǆĐĞƉƚĂƐŽƚŚĞƌǁŝƐĞƉƌŽǀŝĚĞĚŝŶƚŚĞƐĞƉƌŽǀŝƐŝŽŶƐ͕ĂŶǇĚŝƐƉƵƚĞĐŽŶĐĞƌŶŝŶŐĂƋƵĞƐƚŝŽŶŽĨĨĂĐƚĂƌŝƐŝŶŐƵŶĚĞƌƚŚŝƐ ĐŽŶƚƌĂĐƚǁŚŝĐŚŝƐŶŽƚĚŝƐƉŽƐĞĚŽĨďǇĂŐƌĞĞŵĞŶƚƐŚĂůůďĞĚĞĐŝĚĞĚďǇƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚ͕ǁŚŽƐŚĂůůƌĞĚƵĐĞƚŚŝƐ ĚĞĐŝƐŝŽŶƚŽǁƌŝƚŝŶŐĂŶĚŵĂŝůĂĐŽƉǇƚŽƚŚĞďŝĚĚĞƌ͘dŚĞĚĞĐŝƐŝŽŶŽĨƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚƐŚĂůůďĞĨŝŶĂůĂŶĚ ĐŽŶĐůƵƐŝǀĞ͕ƵŶůĞƐƐďŝĚĚĞƌƌĞƋƵĞƐƚƐŵĞĚŝĂƚŝŽŶǁŝƚŚŝŶƚĞŶ;ϭϬͿĐĂůĞŶĚĂƌĚĂǇƐ͘WĞŶĚŝŶŐĨŝŶĂůĚĞĐŝƐŝŽŶŽĨĂĚŝƐƉƵƚĞ͕ ƚŚĞďŝĚĚĞƌƐŚĂůůƉƌŽĐĞĞĚĚŝůŝŐĞŶƚůǇǁŝƚŚƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞĐŽŶƚƌĂĐƚĂŶĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞWƵƌĐŚĂƐŝŶŐ ŐĞŶƚ͛ƐĚĞĐŝƐŝŽŶ͘ ϯϰ͘DĞĚŝĂƚŝŽŶ ^ŚŽƵůĚĂŶƵŶƌĞƐŽůǀĞĚĚŝƐƉƵƚĞĂƌŝƐĞŽƵƚŽĨƚŚŝƐĂŐƌĞĞŵĞŶƚ͕ĂŶǇƉĂƌƚǇŵĂǇƌĞƋƵĞƐƚƚŚĂƚŝƚďĞƐƵďŵŝƚƚĞĚƚŽ ŵĞĚŝĂƚŝŽŶ͘dŚĞƉĂƌƚŝĞƐƐŚĂůůŵĞĞƚŝŶŵĞĚŝĂƚŝŽŶǁŝƚŚŝŶƚŚŝƌƚǇ;ϯ ϬͿĚĂǇƐŽĨĂƌĞƋƵĞƐƚ͘dŚĞŵĞĚŝĂƚŽƌƐŚĂůůďĞĂŐƌĞĞĚ ƚŽďǇƚŚĞŵĞĚŝĂƚŝŶŐƉĂƌƚŝĞƐ͖ŝŶƚŚĞĂďƐĞŶĐĞŽĨĂŶĂŐƌĞĞŵĞŶƚ͕ƚŚĞƉĂƌƚŝĞƐƐŚĂůůĞĂĐŚƐƵďŵŝƚŽŶĞŶĂŵĞĨƌŽŵ ŵĞĚŝĂƚŽƌƐůŝƐƚĞĚďǇĞŝƚŚĞƌƚŚĞŵĞƌŝĐĂŶƌďŝƚƌĂƚŝŽŶƐƐŽĐŝĂƚŝŽŶ͕ƚŚĞĂůŝĨŽƌŶŝĂ^ƚĂƚĞŽĂƌĚŽĨDĞĚŝĂƚŝŽŶĂŶĚ ŽŶĐŝůŝĂƚŝŽŶ͕ŽƌŽƚŚĞƌĂŐƌĞĞĚͲƵƉŽŶƐĞƌǀŝĐĞ͘dŚĞŵĞĚŝĂƚŽƌƐŚĂůůďĞƐĞůĞĐƚĞĚďǇĂůŝŶĚĨŽůĚΛƉƌŽĐĞƐƐ͘ dŚĞĐŽƐƚŽĨŵĞĚŝĂƚŝŽŶƐŚĂůůďĞďŽƌŶĞĞƋƵĂůůǇďǇďŽƚŚƉĂƌƚŝĞƐ͘EĞŝƚŚĞƌƉĂƌƚǇƐŚĂůůďĞĚĞĞŵĞĚƚŚĞƉƌĞǀĂŝůŝŶŐƉĂƌƚǇ͘ EŽƉĂƌƚǇƐŚĂůůďĞƉĞƌŵŝƚƚĞĚƚŽĨŝůĞĂůĞŐĂůĂĐƚŝŽŶǁŝƚŚŽƵƚĨŝƌƐƚŵĞĞƚŝŶŐŝŶŵĞĚŝĂƚŝŽŶĂŶĚŵĂŬŝŶŐĂŐŽŽĚĨĂŝƚŚ ĂƚƚĞŵƉƚƚŽƌĞĂĐŚĂŵĞĚŝĂƚĞĚƐĞƚƚůĞŵĞŶƚ͘dŚĞŵĞĚŝĂƚŝŽŶƉƌŽĐĞƐƐ͕ŽŶĐĞĐŽŵŵĞŶĐĞĚďǇĂŵĞĞƚŝŶŐǁŝƚŚƚŚĞ ŵĞĚŝĂƚŽƌ͕ƐŚĂůůůĂƐƚƵŶƚŝůĂŐƌĞĞŵĞŶƚŝƐƌĞĂĐŚĞĚďǇƚŚĞƉĂƌƚŝĞƐďƵƚŶŽƚŵŽƌĞƚŚĂŶƐŝǆƚǇ;ϲϬͿĚĂǇƐ͕ƵŶůĞƐƐƚŚĞ ŵĂǆŝŵƵŵƚŝŵĞŝƐĞǆƚĞŶĚĞĚďǇďŽƚŚƉĂƌƚŝĞƐ͘ ϯϱ͘>ĂǁĨƵůWĞƌĨŽƌŵĂŶĐĞ Page 494 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϰͮWĂŐĞ ŝĚĚĞƌƐŚĂůůĂďŝĚĞďǇĂůů&ĞĚĞƌĂů͕^ƚĂƚĞĂŶĚ>ŽĐĂů>ĂǁƐ͕KƌĚŝŶĂŶĐĞƐ͕ZĞŐƵůĂƚŝŽŶƐ͕ĂŶĚ^ƚĂƚƵƚĞƐĂƐŵĂǇďĞƌĞůĂƚĞĚ ƚŽƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨĚƵƚŝĞƐƵŶĚĞƌƚŚŝƐĂŐƌĞĞŵĞŶƚ͘/ŶĂĚĚŝƚŝŽŶ͕ĂůůĂƉƉůŝĐĂďůĞƉĞƌŵŝƚƐĂŶĚůŝĐĞŶƐĞƐƌĞƋƵŝƌĞĚ ƐŚĂůůďĞŽďƚĂŝŶĞĚďǇƚŚĞďŝĚĚĞƌ͕ĂƚďŝĚĚĞƌ͛ƐƐŽůĞĞǆƉĞŶƐĞ͘ ϯϲ͘ƵƐŝŶĞƐƐ>ŝĐĞŶƐĞ ŚƵůĂsŝƐƚĂDƵŶŝĐŝƉĂůŽĚĞ^ĞĐƚŝŽŶϱ͘ϬϮ͘ϬϮϬƌĞƋƵŝƌĞƐĂůůĨŝƌŵͬĞŶƚŝƚŝĞƐĚŽŝŶŐďƵƐŝŶĞƐƐǁŝƚŚƚŚĞŝƚǇƚŽŽďƚĂŝŶĂ ƵƐŝŶĞƐƐ>ŝĐĞŶƐĞ͘^ĞĐƚŝŽŶϱ͘ϬϮ͘ϮϬƐƚĂƚĞƐ͗/ƚŝƐƵŶůĂǁĨƵůĨŽƌĂŶǇƉĞƌƐŽŶ͕ŽƌĨŽƌĂŶǇƉĞƌƐŽŶĂƐĂŐĞŶƚ͕ĐůĞƌŬŽƌ ĞŵƉůŽǇĞĞ͕ĞŝƚŚĞƌĨŽƌŚŝŵƐĞůĨŽƌĨŽƌĂŶǇŽƚŚĞƌƉĞƌƐŽŶ͕ǁŝƚŚŝŶƚŚĞĐŽƌƉŽƌĂƚĞůŝŵŝƚƐŽĨƚŚĞŝƚǇ͕ƚŽƚƌĂŶƐĂĐƚ͕ĞŶŐĂŐĞ ŝŶ͕ŽƌĐĂƌƌǇŽŶĂŶǇďƵƐŝŶĞƐƐ͕ƐŚŽǁ͕ĞǆŚŝďŝƚŝŽŶŽƌŐĂŵĞŚĞƌĞŝŶĂĨƚĞƌƐƉĞĐŝĨŝĞĚǁŝƚŚŽƵƚĨŝƌƐƚŚĂǀŝŶŐƉƌŽĐƵƌĞĚĂ ůŝĐĞŶƐĞ͘ ϯϳ͘ŶŶƵĂůƉƉƌŽƉƌŝĂƚŝŽŶŽĨ&ƵŶĚƐ DƵůƚŝͲǇĞĂƌƚĞƌŵƐƵƉƉůǇĂŶĚƐĞƌǀŝĐĞĐŽŶƚƌĂĐƚƐĂŶĚůĞĂƐĞƐĂƌĞƐƵďũĞĐƚƚŽĂŶŶƵĂůĂƉƉƌŽƉƌŝĂƚŝŽŶŽĨĨƵŶĚƐďǇƚŚĞŝƚǇ ŽƵŶĐŝů͘WĂǇŵĞŶƚƐŵĂĚĞƵŶĚĞƌƚĞƌŵĐŽŶƚƌĂĐƚƐĂŶĚůĞĂƐĞƐĂƌĞĐŽŶƐŝĚĞƌĞĚŝƚĞŵƐŽĨĐƵƌƌĞŶƚĞǆƉĞŶƐĞ͘WƵƌĐŚĂƐĞ KƌĚĞƌƐ ĂƌĞ ĨƵŶĚĞĚ ǁŚĞŶ ŝƐƐƵĞĚ͖ ƚŚĞƌĞĨŽƌĞ͕ ƚŚĞǇ ĂƌĞ ĐƵƌƌĞŶƚ ĞǆƉĞŶƐĞ ŝƚĞŵƐ ĂŶĚ ĂƌĞ ŶŽƚ ƐƵďũĞĐƚ ƚŽ ĂŶǇ ƐƵďƐĞƋƵĞŶƚĂƉƉƌŽƉƌŝĂƚŝŽŶŽĨĨƵŶĚƐ͘ /ŶƚŚĞĞǀĞŶƚƐƵĨĨŝĐŝĞŶƚĨƵŶĚƐĂƌĞŶŽƚĂƉƉƌŽƉƌŝĂƚĞĚĨŽƌƚŚĞƉĂǇŵĞŶƚŽĨůĞĂƐĞƉĂǇŵĞŶƚƐŽƌĂŶƚŝĐŝƉĂƚĞĚƚĞƌŵ ĐŽŶƚƌĂĐƚƉĂǇŵĞŶƚƐƌĞƋƵŝƌĞĚƚŽďĞƉĂŝĚŝŶƚŚĞŶĞǆƚŽĐĐƵƌƌŝŶŐůĞĂƐĞŽƌĐŽŶƚƌĂĐƚƚĞƌŵ͕ĂŶĚŝĨŶŽĨƵŶĚƐĂƌĞůĞŐĂůůǇ ĂǀĂŝůĂďůĞĨƌŽŵŽƚŚĞƌƐŽƵƌĐĞƐ͕ƚŚĞůĞĂƐĞŽƌĐŽŶƚƌĂĐƚŵĂǇďĞƚĞƌŵŝŶĂƚĞĚĂƚƚŚĞĞŶĚŽĨƚŚĞŽƌŝŐŝŶĂůƚĞƌŵŽƌƌĞŶĞǁĂů ƚĞƌŵĂŶĚƚŚĞŝƚǇƐŚĂůůŶŽƚďĞŽďůŝŐĂƚĞĚƚŽŵĂŬĞĨƵƌƚŚĞƌƉĂǇŵĞŶƚƐďĞǇŽŶĚƚŚĞƚŚĞŶĐƵƌƌĞŶƚŽƌŝŐŝŶĂůŽƌƌĞŶĞǁĂů ƚĞƌŵ͘dŚĞŝƚǇǁŝůůƉƌŽǀŝĚĞŶŽƚŝĐĞŽĨŝƚƐŝŶĂďŝůŝƚǇƚŽĐŽŶƚŝŶƵĞƚŚĞůĞĂƐĞŽƌĐŽŶƚƌĂĐƚĂƚƐƵĐŚƚŝŵĞĂƐƚŚĞWƵƌĐŚĂƐŝŶŐ ŐĞŶƚŝƐĂǁĂƌĞŽĨƚŚĞŶŽŶͲĂƉƉƌŽƉƌŝĂƚŝŽŶŽĨĨƵŶĚƐ͘,ŽǁĞǀĞƌ͕ĨĂŝůƵƌĞƚŽŶŽƚŝĨǇĚŽĞƐŶŽƚƌĞŶĞǁƚŚĞƚĞƌŵŽĨƚŚĞ ůĞĂƐĞŽƌĐŽŶƚƌĂĐƚ͘dŚĞŝƚǇŚĂƐŶŽŵŽŶĞƚĂƌǇŽďůŝŐĂƚŝŽŶŝŶĞǀĞŶƚŽĨƚĞƌŵŝŶĂƚŝŽŶŽƌƌĞĚƵĐƚŝŽŶŽĨĂƚĞƌŵĐŽŶƚƌĂĐƚ ƐŝŶĐĞƐƵĐŚĐŽŶƚƌĂĐƚƐƌĞƉƌĞƐĞŶƚĞƐƚŝŵĂƚĞĚƋƵĂŶƚŝƚŝĞƐĂŶĚŝƐŶŽƚĨƵŶĚĞĚĂƐĂĐŽŶƚƌĂĐƚĞǆĐĞƉƚƚŽƚŚĞĞǆƚĞŶƚŽĨƚŚĞ WƵƌĐŚĂƐĞKƌĚĞƌƐŝƐƐƵĞĚ͘ ϯϴ͘ǆƚĞŶƐŝŽŶ tŚĞŶŝŶƚŚĞŝƚǇ͛ƐďĞƐƚŝŶƚĞƌĞƐƚ͕ƚŚŝƐĂŐƌĞĞŵĞŶƚŵĂǇďĞĞǆƚĞŶĚĞĚŽŶĂĚĂŝůǇ͕ŵŽŶƚŚͲƚŽͲŵŽŶƚŚ͕ŽƌĂŶŶƵĂůďĂƐŝƐ ďǇŵƵƚƵĂůĂŐƌĞĞŵĞŶƚŽĨďŽƚŚƉĂƌƚŝĞƐ͘^ĞƌǀŝĐĞƐĂŶĚͬŽƌŵĂƚĞƌŝĂůƐƌĞĐĞŝǀĞĚƵŶĚĞƌĂŶĞǆƚĞŶƐŝŽŶƐŚĂůůďĞŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚƉƌŝĐŝŶŐ͕ƚĞƌŵƐ͕ĂŶĚĐŽŶĚŝƚŝŽŶƐ͕ĂƐĚĞƐĐƌŝďĞĚŚĞƌĞŝŶ͘ ϯϵ͘ĞďĂƌŵĞŶƚ dŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚŵĂǇƌĞĐŽŵŵĞŶĚƚŽƚŚĞŝƚǇŽƵŶĐŝůƚŚĂƚƚŚĞƉĞƌƐŽŶŽƌďƵƐŝŶĞƐƐďĞĚĞďĂƌƌĞĚĨƌŽŵ ĐŽŶƐŝĚĞƌĂƚŝŽŶĨŽƌĂǁĂƌĚŽĨĐŽŶƚƌĂĐƚƐ͘dŚĞƉĞƌŝŽĚŽĨĚĞďĂƌŵĞŶƚǁŝůůďĞĐŽŶƚŝŶŐĞŶƚƵƉŽŶƚŚĞƐĞǀĞƌŝƚǇŽĨĐĂƵƐĞ͘ ĂƵƐĞƐĨŽƌĚĞďĂƌŵĞŶƚŝŶĐůƵĚĞ͗ ĂͿŽŶǀŝĐƚŝŽŶ ƵŶĚĞƌ ƐƚĂƚĞ Žƌ ĨĞĚĞƌĂů ƐƚĂƚƵƚĞƐ ŽĨ ĞŵďĞǌǌůĞŵĞŶƚ͕ƚŚĞĨƚ͕ ĨŽƌŐĞƌǇ͕ ďƌŝďĞƌǇ͕ ĨĂůƐŝĨŝĐĂƚŝŽŶ Žƌ ĚĞƐƚƌƵĐƚŝŽŶŽĨƌĞĐŽƌĚƐ͕ƌĞĐĞŝǀŝŶŐƐƚŽůĞŶƉƌŽƉĞƌƚǇ͕ŽƌŽƚŚĞƌŽĨĨĞŶƐĞŝŶĚŝĐĂƚŝŶŐĂůĂĐŬŽĨďƵƐŝŶĞƐƐŝŶƚĞŐƌŝƚǇ ŽƌďƵƐŝŶĞƐƐŚŽŶĞƐƚǇ ďͿsŝŽůĂƚŝŽŶŽĨĐŽŶƚƌĂĐƚƉƌŽǀŝƐŝŽŶƐǁŚŝĐŚŝƐƌĞŐĂƌĚĞĚďǇƚŚĞWƵƌĐŚĂƐŝŶŐŐĞŶƚƚŽďĞƐŽƐĞƌŝŽƵƐĂƐƚŽũƵƐƚŝĨǇ ĚĞďĂƌŵĞŶƚĂĐƚŝŽŶ͕ŝŶĐůƵĚŝŶŐ͗ ŝ͘ĞůŝďĞƌĂƚĞĨĂŝůƵƌĞǁŝƚŚŽƵƚŐŽŽĚĐĂƵƐĞƚŽƉĞƌĨŽƌŵŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƐƉĞĐŝĨŝĐĂƚŝŽŶƐŽƌ ǁŝƚŚŝŶƚŚĞƚŝŵĞůŝŵŝƚƉƌŽǀŝĚĞĚŝŶƚŚĞĐŽŶƚƌĂĐƚ͖Žƌ ŝŝ͘ƌĞĐĞŶƚƌĞĐŽƌĚŽĨĨĂŝůƵƌĞƚŽƉĞƌĨŽƌŵŽƌŽĨƵŶƐĂƚŝƐĨĂĐƚŽƌǇƉĞƌĨŽƌŵĂŶĐĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ ƚĞƌŵƐŽĨŽŶĞŽƌŵŽƌĞĐŽŶƚƌĂĐƚƐ͕Žƌ ŝŝŝ͘dǁŽŽƌŵŽƌĞĐůĂŝŵƐŽĨĐŽŵƉƵƚĂƚŝŽŶĂůĞƌƌŽƌŝŶďŝĚƐƵďŵŝƐƐŝŽŶǁŝƚŚŝŶĂƚǁŽͲǇĞĂƌƉĞƌŝŽĚ͘ Page 495 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϱͮWĂŐĞ ĐͿĞďĂƌŵĞŶƚďǇĂŶŽƚŚĞƌŐŽǀĞƌŶŵĞŶƚĂůĞŶƚŝƚǇ͘ ĚͿ$Q\RWKHUFDXVHWKH3XUFKDVLQJ$JHQWGHHPVWREHVRVHULRXVDQGFRPSHOOLQJDVWRDIIHFWUHVSRQVLELOLW\DV D&LW\ELGGHU$ELGGHUPD\EHSHUPDQHQWO\GHEDUUHGIRUWKHIROORZLQJFDXVHV ŝ͘ŽůůƵƐŝŽŶŝŶďŝĚĚŝŶŐ ŝŝ͘ŽŶǀŝĐƚŝŽŶĨŽƌĐŽŵŵŝƐƐŝŽŶŽĨĂĐƌŝŵŝŶĂůŽĨĨĞŶƐĞĂƐĂŶŝŶĐŝĚĞŶƚƚŽŽďƚĂŝŶŝŶŐŽƌĂƚƚĞŵƉƚŝŶŐƚŽ ŽďƚĂŝŶĂĐŽŶƚƌĂĐƚŽƌƐƵďĐŽŶƚƌĂĐƚǁŝƚŚƚŚĞŝƚǇŽĨŚƵůĂsŝƐƚĂŽƌŝŶƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƐƵĐŚ ĐŽŶƚƌĂĐƚŽƌƐƵďĐŽŶƚƌĂĐƚ͘ ŝŝŝ͘ŽŶǀŝĐƚŝŽŶƵŶĚĞƌ^ƚĂƚĞŽƌ&ĞĚĞƌĂůĂŶƚŝƚƌƵƐƚƐƚĂƚƵƚĞƐĂƌŝƐŝŶŐŽƵƚŽĨƚŚĞƐƵďŵŝƐƐŝŽŶŽĨďŝĚƐŽƌ ƉƌŽƉŽƐĂůƐ͘ ϰϬ͘sĞŶƵĞ dŚŝƐĂŐƌĞĞŵĞŶƚƐŚĂůůďĞŐŽǀĞƌŶĞĚďǇĂŶĚŝŶƚĞƌƉƌĞƚĞĚĂĐĐŽƌĚŝŶŐƚŽƚŚĞůĂǁƐŽĨƚŚĞ^ƚĂƚĞŽĨĂůŝĨŽƌŶŝĂ͕ĂŶĚǀĞŶƵĞ ĨŽƌĂŶǇƉƌŽĐĞĞĚŝŶŐƐŚĂůůďĞŝŶƚŚĞŽƵŶƚǇŽĨ^ĂŶŝĞŐŽ͘ ;Zs&ĞďƌƵĂƌǇϮϬϮϭͿ Page 496 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϲͮWĂŐĞ 7+(&,7<¶667$1'$5'3$57<$*5((0(17)25&2168/7$176(59,&(6,6$77$&+(' )255(9,(:7+(&,7<:,//&216,'(5$1<127('(;&(37,216:+,/(0$.,1*7+(,5 6(/(&7,21 &,7<2)&+8/$9,67$ &2168/7$176(59,&(6$*5((0(17 :,7+&,7<2)&+8/$9,67$ 723529,'(>6(59,&(672%(3529,'('@ 7KLV$JUHHPHQWLVHQWHUHGLQWRHIIHFWLYHDVRI(QWHU'DWH³(IIHFWLYH'DWH´E\DQGEHWZHHQWKH &LW\RI&KXOD9LVWDDFKDUWHUHGPXQLFLSDOFRUSRUDWLRQ³&LW\´DQG&LW\RI&KXOD9LVWD(QWLW\ 7\SHHJ$&DOLIRUQLD&RUSRUDWLRQ³&RQVXOWDQW´FROOHFWLYHO\WKH³3DUWLHV´DQGLQGLYLGXDOO\ D³3DUW\´ZLWKUHIHUHQFHWRWKHIROORZLQJIDFWV 5(&,7$/6 :+(5($6(QWHU5HFLWDOV7R'HVFULEH%DVLV)RU6HUYLFH±6HHH[DPSOHEHORZDQG :+(5($6(QWHU5HFLWDOV7R'HVFULEH&RQVXOWDQW6HOHFWLRQ3URFHVV±6HHH[DPSOH EHORZDQG (QWHU$GGLWLRQDO5HFLWDOV$V1HHGHG2U'HOHWH7KLV/LQH :+(5($6&RQVXOWDQWZDUUDQWVDQGUHSUHVHQWVWKDWLWLVH[SHULHQFHGDQGVWDIIHGLQD PDQQHUVXFKWKDWLWFDQGHOLYHUWKHVHUYLFHVUHTXLUHGRI&RQVXOWDQWWR&LW\LQDFFRUGDQFHZLWKWKH WLPHIUDPHVDQGWKHWHUPVDQGFRQGLWLRQVRIWKLV$JUHHPHQW ,I&LW\&RXQFLODSSURYHGLQVHUWGDWHRI&LW\&RXQFLODSSURYDO2WKHUZLVHLQVHUWDGDWHQRODWHUWKDQGDWH&RQVXOWDQW¶VZRUN FRPPHQFHV Ϯ)RUH[DPSOH³:+(5($6&LW\UHTXLUHVBBBBBBBBBBBBB>HJFLYLOHQJLQHHULQJ@VHUYLFHVLQRUGHUWRBBBBBBBBBBBBBBBBBBBB >HJGHVLJQDQHZLQWHUVHFWLRQDW;DQG<VWUHHWV@´DQG ϯ)RUH[DPSOH³:+(5($6,QRUGHUWRSURFXUHWKHVHVHUYLFHV&LW\VROLFLWHGSURSRVDOVLQDFFRUGDQFHZLWK&KXOD9LVWD0XQLFLSDO &RGH6HFWLRQBBBBBBBBBBBBBBBBB>IRUFRQWUDFWVH[FHHGLQJIRUFRQWUDFWVRIRUOHVV IRU³SURIHVVLRQDOVHUYLFHV´HJDUFKLWHFWVODZ\HUVHQJLQHHUVHQYLURQPHQWDO@UHFHLYHGBBSURSRVDOVDQGVHOHFWHG &RQVXOWDQWDVWKHPRVWTXDOLILHGDPRQJVWWKRVHVXEPLWWLQJDQG´ >25LIWKHSURMHFWZDVVROHVRXUFHG@ ³:+(5($6,QRUGHUWRSURFXUHWKHVHVHUYLFHV&RQVXOWDQWZDVFKRVHQEDVHGRQ&RQVXOWDQW¶VXQLTXHTXDOLILFDWLRQV LQFOXGLQJBBBBBBBBBBBBBBBBRQWKLVEDVLV&RQVXOWDQWZDVDZDUGHGWKHFRQWUDFWRQD³VROHVRXUFH´EDVLVXQGHUWKHDXWKRULW\ RI&KXOD9LVWD0XQLFLSDO&RGH6HFWLRQBBBBBBBBBBBB>%IRUFRQWUDFWVDSSURYHGE\&LW\&RXQFLO% IRUFRQWUDFWVDSSURYHGDWDVWDIIOHYHO@´ >25LIDQDOWHUQDWLYHSURFXUHPHQWSURFHVVLVXVHG@ ³:+(5($6,QRUGHUWRSURFXUHWKHVHVHUYLFHV&RQVXOWDQWZDVFKRVHQBBBBBBBBBBBBBBBBBB´ &RQVXOWZLWKWKH&LW\$WWRUQH\¶V2IILFHLIQRQHRIWKHVHDSSO\ Page 497 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϳͮWĂŐĞ >(QGRI5HFLWDOV1H[W3DJH6WDUWV2EOLJDWRU\3URYLVLRQV@ Page 498 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϴͮWĂŐĞ 2%/,*$725<3529,6,216 12:7+(5()25(LQFRQVLGHUDWLRQRIWKHDERYHUHFLWDOVWKHFRYHQDQWVFRQWDLQHG KHUHLQDQGRWKHUJRRGDQGYDOXDEOHFRQVLGHUDWLRQWKHUHFHLSWDQGVXIILFLHQF\RIZKLFKWKH 3DUWLHVKHUHE\DFNQRZOHGJH&LW\DQG&RQVXOWDQWKHUHE\DJUHHDVIROORZV 6(59,&(6 5HTXLUHG6HUYLFHV&RQVXOWDQWDJUHHVWRSHUIRUPWKHVHUYLFHVDQGGHOLYHUWR&LW\WKH ³'HOLYHUDEOHV´LIDQ\GHVFULEHGLQWKHDWWDFKHG([KLELW$LQFRUSRUDWHGLQWRWKH$JUHHPHQW E\WKLVUHIHUHQFHZLWKLQWKHWLPHIUDPHVVHWIRUWKWKHUHLQWLPHEHLQJRIWKHHVVHQFHIRUWKLV $JUHHPHQW7KHVHUYLFHVDQGRU'HOLYHUDEOHVGHVFULEHGLQ([KLELW$VKDOOEHUHIHUUHGWRKHUHLQ DVWKH³5HTXLUHG6HUYLFHV´ 5HGXFWLRQV LQ 6FRSH RI :RUN&LW\ PD\ LQGHSHQGHQWO\ RU XSRQ UHTXHVW IURP &RQVXOWDQWIURPWLPHWRWLPHUHGXFHWKH5HTXLUHG6HUYLFHVWREHSHUIRUPHGE\WKH&RQVXOWDQW XQGHUWKLV$JUHHPHQW8SRQGRLQJVR&LW\DQG&RQVXOWDQWDJUHHWRPHHWDQGFRQIHULQJRRG IDLWKIRUWKHSXUSRVHRIQHJRWLDWLQJDFRUUHVSRQGLQJUHGXFWLRQLQWKHFRPSHQVDWLRQDVVRFLDWHG ZLWKWKHUHGXFWLRQ $GGLWLRQDO6HUYLFHV6XEMHFWWRFRPSOLDQFHZLWKWKH&LW\¶V&KDUWHUFRGHVSROLFLHV SURFHGXUHVDQGRUGLQDQFHVJRYHUQLQJSURFXUHPHQWDQGSXUFKDVLQJDXWKRULW\&LW\PD\UHTXHVW &RQVXOWDQW SURYLGH DGGLWLRQDO VHUYLFHV UHODWHG WR WKH 5HTXLUHG6HUYLFHV ³$GGLWLRQDO 6HUYLFHV´,IVR&LW\DQG&RQVXOWDQWDJUHHWRPHHWDQGFRQIHULQJRRGIDLWKIRUWKHSXUSRVH RIQHJRWLDWLQJDQDPHQGPHQWWR([KLELW$WRDGGWKH$GGLWLRQDO6HUYLFHV8QOHVVRWKHUZLVH DJUHHGFRPSHQVDWLRQIRUWKH$GGLWLRQDO6HUYLFHVVKDOOEHFKDUJHGDQGSDLGFRQVLVWHQWZLWKWKH UDWHVDQGWHUPVDOUHDG\SURYLGHGWKHUHLQ2QFHDGGHGWR([KLELW$³$GGLWLRQDO6HUYLFHV´VKDOO DOVREHFRPH³5HTXLUHG6HUYLFHV´IRUSXUSRVHVRIWKLV$JUHHPHQW 6WDQGDUGRI&DUH&RQVXOWDQWH[SUHVVO\ZDUUDQWVDQGDJUHHVWKDWDQ\DQGDOO5HTXLUHG 6HUYLFHV KHUHXQGHU VKDOO EH SHUIRUPHG LQ DFFRUGDQFH ZLWK WKH KLJKHVW VWDQGDUG RI FDUH H[HUFLVHGE\PHPEHUVRIWKHSURIHVVLRQFXUUHQWO\SUDFWLFLQJXQGHUVLPLODUFRQGLWLRQVDQGLQ VLPLODUORFDWLRQV 1R:DLYHURI6WDQGDUGRI&DUH:KHUHDSSURYDOE\&LW\LVUHTXLUHGLWLVXQGHUVWRRG WREH FRQFHSWXDO DSSURYDO RQO\ DQG GRHV QRW UHOLHYH WKH &RQVXOWDQWRI UHVSRQVLELOLW\IRU FRPSO\LQJ ZLWK DOO ODZV FRGHV LQGXVWU\ VWDQGDUGV DQG OLDELOLW\ IRU GDPDJHV FDXVHG E\ QHJOLJHQW DFWV HUURUV RPLVVLRQV QRQFRPSOLDQFH ZLWK LQGXVWU\VWDQGDUGV RU WKH ZLOOIXO PLVFRQGXFWRIWKH&RQVXOWDQWRULWVVXEFRQWUDFWRUV 6HFXULW\IRU3HUIRUPDQFH,QWKHHYHQWWKDW([KLELW$6HFWLRQLQGLFDWHVWKHQHHGIRU &RQVXOWDQWWRSURYLGHDGGLWLRQDOVHFXULW\IRUSHUIRUPDQFHRILWVGXWLHVXQGHUWKLV$JUHHPHQW &RQVXOWDQWVKDOOSURYLGHVXFKDGGLWLRQDOVHFXULW\SULRUWRFRPPHQFHPHQWRILWV5HTXLUHG Page 499 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϭϵͮWĂŐĞ 6HUYLFHVLQWKHIRUPDQGRQWKHWHUPVSUHVFULEHGRQ([KLELW$RUDVRWKHUZLVHSUHVFULEHGE\ WKH&LW\$WWRUQH\ &RPSOLDQFHZLWK/DZV ,QLWVSHUIRUPDQFHRIWKH5HTXLUHG6HUYLFHV&RQVXOWDQW VKDOOFRPSO\ZLWKDQ\DQGDOODSSOLFDEOHIHGHUDOVWDWHDQGORFDOODZVLQFOXGLQJWKH&KXOD 9LVWD0XQLFLSDO&RGH %XVLQHVV/LFHQVH3ULRUWRFRPPHQFHPHQWRIZRUN&RQVXOWDQWVKDOOREWDLQDEXVLQHVV OLFHQVHIURP&LW\ 6XEFRQWUDFWRUV3ULRUWRFRPPHQFHPHQWRIDQ\ZRUN&RQVXOWDQWVKDOOVXEPLWIRU &LW\¶VLQIRUPDWLRQDQGDSSURYDODOLVWRIDQ\DQGDOOVXEFRQWUDFWRUVWREHXVHGE\&RQVXOWDQW LQWKHSHUIRUPDQFHRIWKH5HTXLUHG6HUYLFHV&RQVXOWDQWDJUHHVWRWDNHDSSURSULDWHPHDVXUHV QHFHVVDU\WRHQVXUHWKDWDOOVXEFRQWUDFWRUVDQGSHUVRQQHOXWLOL]HGE\WKH&RQVXOWDQWWRFRPSOHWH LWVREOLJDWLRQVXQGHUWKLV$JUHHPHQWFRPSO\ZLWKDOODSSOLFDEOHODZVUHJXODWLRQVRUGLQDQFHV DQGSROLFLHVZKHWKHUIHGHUDOVWDWHRUORFDO,QDGGLWLRQLIDQ\VXEFRQWUDFWRULVH[SHFWHGWR IXOILOODQ\UHVSRQVLELOLWLHVRIWKH&RQVXOWDQWXQGHUWKLV$JUHHPHQW&RQVXOWDQWVKDOOHQVXUHWKDW HDFKDQGHYHU\VXEFRQWUDFWRUFDUULHVRXWWKH&RQVXOWDQW¶VUHVSRQVLELOLWLHVDVVHWIRUWKLQWKLV $JUHHPHQW 7HUP7KLV$JUHHPHQWVKDOOFRPPHQFHRQWKHHDUOLHUWRRFFXURIWKH(IIHFWLYH'DWHRU &RQVXOWDQW¶VFRPPHQFHPHQWRIWKH5HTXLUHG6HUYLFHVKHUHXQGHUDQGVKDOOWHUPLQDWHVXEMHFW WR6HFWLRQVDQGRIWKLV$JUHHPHQWZKHQWKH3DUWLHVKDYHFRPSOLHGZLWKDOOWKHLU REOLJDWLRQVKHUHXQGHUSURYLGHGKRZHYHUSURYLVLRQVZKLFKH[SUHVVO\VXUYLYHWHUPLQDWLRQ VKDOOUHPDLQLQHIIHFW &203(16$7,21 *HQHUDO )RU VDWLVIDFWRU\ SHUIRUPDQFH RI WKH 5HTXLUHG 6HUYLFHV &LW\ DJUHHV WR FRPSHQVDWH&RQVXOWDQWLQWKHDPRXQWVDQGRQWKHWHUPVVHWIRUWKLQ([KLELW$6HFWLRQ 6WDQGDUGWHUPVIRUELOOLQJDQGSD\PHQWDUHVHWIRUWKLQWKLV6HFWLRQ 'HWDLOHG ,QYRLFLQJ&RQVXOWDQW DJUHHV WR SURYLGH &LW\ ZLWK D GHWDLOHG LQYRLFH IRU VHUYLFHVSHUIRUPHGHDFKPRQWKZLWKLQWKLUW\GD\VRIWKHHQGRIWKHPRQWKLQZKLFKWKH VHUYLFHVZHUHSHUIRUPHGXQOHVVRWKHUZLVHVSHFLILHGLQ([KLELW$,QYRLFLQJVKDOOEHJLQRQWKH ILUVWRIWKHPRQWKIROORZLQJWKH(IIHFWLYH'DWHRIWKH$JUHHPHQW$OOFKDUJHVPXVWEH SUHVHQWHGLQDOLQHLWHPIRUPDWZLWKHDFKWDVNVHSDUDWHO\H[SODLQHGLQUHDVRQDEOHGHWDLO(DFK LQYRLFHVKDOOLQFOXGHWKHFXUUHQWPRQWKO\DPRXQWEHLQJELOOHGWKHDPRXQWLQYRLFHGWRGDWH DQGWKHUHPDLQLQJDPRXQWDYDLODEOHXQGHUDQ\DSSURYHGEXGJHW&RQVXOWDQWPXVWREWDLQSULRU ZULWWHQDXWKRUL]DWLRQIURP&LW\IRUDQ\IHHVRUH[SHQVHVWKDWH[FHHGWKHHVWLPDWHGEXGJHW 3D\PHQWWR&RQVXOWDQW8SRQUHFHLSWRIDSURSHUO\SUHSDUHGLQYRLFHDQGFRQILUPDWLRQ WKDWWKH5HTXLUHG6HUYLFHVGHWDLOHGLQWKHLQYRLFHKDYHEHHQVDWLVIDFWRULO\SHUIRUPHG&LW\VKDOO SD\&RQVXOWDQWIRUWKHLQYRLFHDPRXQWZLWKLQWKLUW\GD\V3D\PHQWVKDOOEHPDGHLQ Page 500 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϬͮWĂŐĞ DFFRUGDQFHZLWKWKHWHUPVDQGFRQGLWLRQVVHWIRUWKLQ([KLELW$DQGVHFWLRQEHORZ$W &LW\¶VGLVFUHWLRQLQYRLFHVQRWWLPHO\VXEPLWWHGPD\EHVXEMHFWWRDSHQDOW\RIXSWRILYH SHUFHQWRIWKHDPRXQWLQYRLFHG 5HWHQWLRQ3ROLF\ &LW\VKDOOUHWDLQWHQSHUFHQWRIWKHDPRXQWGXHIRU5HTXLUHG 6HUYLFHV GHWDLOHG RQ HDFK LQYRLFH WKH ³KROGEDFN DPRXQW´ 8SRQ &LW\ UHYLHZ DQG GHWHUPLQDWLRQRI3URMHFW&RPSOHWLRQWKHKROGEDFNDPRXQWZLOOEHLVVXHGWR&RQVXOWDQW 5HLPEXUVHPHQWRI&RVWV&LW\PD\UHLPEXUVH&RQVXOWDQW¶VRXWRISRFNHW FRVWV LQFXUUHGE\&RQVXOWDQWLQWKHSHUIRUPDQFHRIWKH5HTXLUHG6HUYLFHVLIQHJRWLDWHGLQDGYDQFH DQGLQFOXGHGLQ([KLELW$8QOHVVVSHFLILFDOO\SURYLGHGLQ([KLELW$&RQVXOWDQWVKDOOEH UHVSRQVLEOHIRUDQ\DQGDOORXWRISRFNHWFRVWVLQFXUUHGE\&RQVXOWDQWLQWKHSHUIRUPDQFHRI WKH5HTXLUHG6HUYLFHV ([FOXVLRQV&LW\VKDOOQRWEHUHVSRQVLEOHIRUSD\PHQWWR&RQVXOWDQWIRUDQ\IHHVRU FRVWVLQH[FHVVRIDQ\DJUHHGXSRQEXGJHWUDWHRURWKHUPD[LPXPDPRXQWVSURYLGHGIRULQ ([KLELW$&LW\VKDOODOVRQRWEHUHVSRQVLEOHIRUDQ\FRVWDLQFXUUHGSULRUWRWKH(IIHFWLYH 'DWHRUEDULVLQJRXWRIRUUHODWHGWRWKHHUURUVRPLVVLRQVQHJOLJHQFHRUDFWVRIZLOOIXO PLVFRQGXFWRI&RQVXOWDQWLWVDJHQWVHPSOR\HHVRUVXEFRQWUDFWRUV 3D\PHQW1RW)LQDO$SSURYDO&RQVXOWDQWXQGHUVWDQGVDQGDJUHHVWKDWSD\PHQWWRWKH &RQVXOWDQWRUUHLPEXUVHPHQWIRUDQ\&RQVXOWDQWFRVWVUHODWHGWRWKHSHUIRUPDQFHRI5HTXLUHG 6HUYLFHVGRHVQRWFRQVWLWXWHD&LW\ILQDOGHFLVLRQUHJDUGLQJZKHWKHUVXFKSD\PHQWRUFRVW UHLPEXUVHPHQW LV DOORZDEOH DQG HOLJLEOH IRU SD\PHQW XQGHU WKLV$JUHHPHQW QRU GRHV LW FRQVWLWXWHDZDLYHURIDQ\YLRODWLRQE\&RQVXOWDQWRIWKHWHUPVRIWKLV$JUHHPHQW,I&LW\ GHWHUPLQHVWKDW&RQVXOWDQWLVQRWHQWLWOHGWRUHFHLYHDQ\DPRXQWRIFRPSHQVDWLRQDOUHDG\SDLG &LW\ZLOOQRWLI\&RQVXOWDQWLQZULWLQJDQG&RQVXOWDQWVKDOOSURPSWO\UHWXUQVXFKDPRXQW ,1685$1&( 5HTXLUHG ,QVXUDQFH &RQVXOWDQW PXVWSURFXUH DQG PDLQWDLQ GXULQJ WKH SHULRG RI SHUIRUPDQFH RI 5HTXLUHG 6HUYLFHV XQGHU WKLV $JUHHPHQW DQG IRUWZHOYH PRQWKV DIWHU FRPSOHWLRQRI5HTXLUHG6HUYLFHVWKHSROLFLHVRILQVXUDQFHGHVFULEHGRQWKHDWWDFKHG([KLELW % LQFRUSRUDWHG LQWR WKH $JUHHPHQW E\ WKLV UHIHUHQFH WKH ³5HTXLUHG ,QVXUDQFH´ 7KH 5HTXLUHG,QVXUDQFHVKDOODOVRFRPSO\ZLWKDOORWKHUWHUPVRIWKLV6HFWLRQ 'HGXFWLEOHVDQG6HOI,QVXUHG5HWHQWLRQV$Q\GHGXFWLEOHVRUVHOILQVXUHGUHWHQWLRQV UHODWLQJWRWKH5HTXLUHG,QVXUDQFHPXVWEHGLVFORVHGWRDQGDSSURYHGE\&LW\LQDGYDQFHRIWKH FRPPHQFHPHQWRIZRUN 6WDQGDUGVIRU,QVXUHUV5HTXLUHG,QVXUDQFHPXVWEHSODFHGZLWKOLFHQVHGLQVXUHUV DGPLWWHGWRWUDQVDFWEXVLQHVVLQWKH6WDWHRI&DOLIRUQLDZLWKDFXUUHQW$0%HVW¶VUDWLQJRI$ 9RUEHWWHURULILQVXUDQFHLVSODFHGZLWKDVXUSOXVOLQHVLQVXUHULQVXUHUPXVWEHOLVWHGRQWKH 6WDWHRI&DOLIRUQLD/LVWRI(OLJLEOH6XUSOXV/LQHV,QVXUHUV/(6/,ZLWKDFXUUHQW$0%HVW¶V Page 501 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϭͮWĂŐĞ UDWLQJRIQROHVVWKDQ$;)RU:RUNHUV¶&RPSHQVDWLRQ,QVXUDQFHLQVXUDQFHLVVXHGE\WKH 6WDWH&RPSHQVDWLRQ)XQGLVDOVRDFFHSWDEOH 6XEFRQWUDFWRUV &RQVXOWDQW PXVW LQFOXGH DOO VXEFRQVXOWDQWVVXEFRQWUDFWRUV DV LQVXUHGVXQGHULWVSROLFLHVDQGRUIXUQLVKVHSDUDWHFHUWLILFDWHVDQGHQGRUVHPHQWVGHPRQVWUDWLQJ VHSDUDWHFRYHUDJHIRUWKRVHQRWXQGHULWVSROLFLHV$Q\VHSDUDWHFRYHUDJHIRUVXEFRQVXOWDQWV PXVWDOVRFRPSO\ZLWKWKHWHUPVRIWKLV$JUHHPHQW $GGLWLRQDO,QVXUHGV&LW\LWVRIILFHUVRIILFLDOVHPSOR\HHVDJHQWVDQGYROXQWHHUV PXVW EH QDPHG DV DGGLWLRQDO LQVXUHGV ZLWK UHVSHFW WR DQ\ SROLF\ RI JHQHUDO OLDELOLW\ DXWRPRELOHRUSROOXWLRQLQVXUDQFHVSHFLILHGDVUHTXLUHGLQ([KLELW%RUDVPD\RWKHUZLVHEH VSHFLILHGE\&LW\¶V5LVN0DQDJHU7KHJHQHUDOOLDELOLW\DGGLWLRQDOLQVXUHGFRYHUDJHPXVWEH SURYLGHGLQWKHIRUPRIDQHQGRUVHPHQWWRWKH&RQVXOWDQW¶VLQVXUDQFHXVLQJ,62&* RULWVHTXLYDOHQWVXFKHQGRUVHPHQWPXVWQRWH[FOXGH3URGXFWV&RPSOHWHG2SHUDWLRQV FRYHUDJH *HQHUDO/LDELOLW\&RYHUDJHWREH³3ULPDU\´&RQVXOWDQW¶VJHQHUDOOLDELOLW\FRYHUDJH PXVWEHSULPDU\LQVXUDQFHDVLWSHUWDLQVWRWKH&LW\LWVRIILFHUVRIILFLDOVHPSOR\HHVDJHQWV DQGYROXQWHHUV$Q\LQVXUDQFHRUVHOILQVXUDQFHPDLQWDLQHGE\WKH&LW\LWVRIILFHUVRIILFLDOV HPSOR\HHVRUYROXQWHHUVLVZKROO\VHSDUDWHIURPWKHLQVXUDQFHSURYLGHGE\&RQVXOWDQWDQGLQ QRZD\UHOLHYHV&RQVXOWDQWIURPLWVUHVSRQVLELOLW\WRSURYLGHLQVXUDQFH 1R&DQFHOODWLRQ1R5HTXLUHG,QVXUDQFHSROLF\PD\EHFDQFHOHGE\HLWKHU3DUW\GXULQJ WKHUHTXLUHGLQVXUHGSHULRGXQGHUWKLV$JUHHPHQWH[FHSWDIWHUWKLUW\GD\V¶SULRUZULWWHQQRWLFH WRWKH&LW\E\FHUWLILHGPDLOUHWXUQUHFHLSWUHTXHVWHG3ULRUWRWKHHIIHFWLYHGDWHRIDQ\VXFK FDQFHOODWLRQ&RQVXOWDQWPXVWSURFXUHDQGSXWLQWRHIIHFWHTXLYDOHQWFRYHUDJHV :DLYHURI6XEURJDWLRQ&RQVXOWDQW¶VLQVXUHUVZLOOSURYLGHD:DLYHURI6XEURJDWLRQ LQIDYRURIWKH&LW\IRUHDFK5HTXLUHG,QVXUDQFHSROLF\XQGHUWKLV$JUHHPHQW,QDGGLWLRQ &RQVXOWDQWZDLYHVDQ\ULJKWLWPD\KDYHRUPD\REWDLQWRVXEURJDWLRQIRUDFODLPDJDLQVW&LW\ 9HULILFDWLRQRI&RYHUDJH3ULRUWRFRPPHQFHPHQWRIDQ\ZRUN&RQVXOWDQWVKDOO IXUQLVK &LW\ ZLWK RULJLQDO FHUWLILFDWHV RI LQVXUDQFH DQG DQ\ DPHQGDWRU\ HQGRUVHPHQWV QHFHVVDU\WRGHPRQVWUDWHWR&LW\WKDW&RQVXOWDQWKDVREWDLQHGWKH5HTXLUHG ,QVXUDQFHLQ FRPSOLDQFHZLWKWKHWHUPVRIWKLV$JUHHPHQW7KHZRUGV³ZLOOHQGHDYRU´DQG³EXWIDLOXUHWR PDLOVXFKQRWLFHVKDOOLPSRVHQRREOLJDWLRQRUOLDELOLW\RIDQ\NLQGXSRQWKHFRPSDQ\LWV DJHQWVRUUHSUHVHQWDWLYHV´RUDQ\VLPLODUODQJXDJHPXVWEHGHOHWHGIURPDOOFHUWLILFDWHV7KH UHTXLUHGFHUWLILFDWHVDQGHQGRUVHPHQWVVKRXOGRWKHUZLVHEHRQLQGXVWU\VWDQGDUGIRUPV7KH &LW\ UHVHUYHV WKH ULJKW WR UHTXLUH DW DQ\ WLPH FRPSOHWH FHUWLILHG FRSLHV RI DOO UHTXLUHG LQVXUDQFH SROLFLHV LQFOXGLQJ HQGRUVHPHQWV HYLGHQFLQJ WKH FRYHUDJH UHTXLUHG E\ WKHVH VSHFLILFDWLRQV Page 502 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϮͮWĂŐĞ &ODLPV0DGH3ROLF\5HTXLUHPHQWV,I*HQHUDO/LDELOLW\3ROOXWLRQDQGRU$VEHVWRV 3ROOXWLRQ/LDELOLW\DQGRU(UURUV 2PLVVLRQVFRYHUDJHDUHUHTXLUHGDQGDUHSURYLGHGRQD FODLPVPDGHIRUPWKHIROORZLQJUHTXLUHPHQWVDOVRDSSO\ D 7KH³5HWUR'DWH´PXVWEHVKRZQDQGPXVWEHEHIRUHWKHGDWHRIWKLV$JUHHPHQW RUWKHEHJLQQLQJRIWKHZRUNUHTXLUHGE\WKLV$JUHHPHQW E ,QVXUDQFHPXVWEHPDLQWDLQHGDQGHYLGHQFHRILQVXUDQFHPXVWEHSURYLGHGIRUDW OHDVWILYH\HDUVDIWHUFRPSOHWLRQRIWKHZRUNUHTXLUHGE\WKLV$JUHHPHQW F ,IFRYHUDJHLVFDQFHOHGRUQRQUHQHZHGDQGQRWUHSODFHGZLWKDQRWKHUFODLPVPDGH SROLF\IRUPZLWKD³5HWUR'DWH´SULRUWRWKHHIIHFWLYHGDWHRIWKLV$JUHHPHQWWKH&RQVXOWDQW PXVWSXUFKDVH³H[WHQGHGUHSRUWLQJ´FRYHUDJHIRUDPLQLPXPRIILYH\HDUVDIWHUFRPSOHWLRQ RIWKHZRUNUHTXLUHGE\WKLV$JUHHPHQW G $FRS\RIWKHFODLPVUHSRUWLQJUHTXLUHPHQWVPXVWEHVXEPLWWHGWRWKH&LW\IRU UHYLHZ 1RWD/LPLWDWLRQRI2WKHU2EOLJDWLRQV,QVXUDQFHSURYLVLRQVXQGHUWKLVVHFWLRQVKDOO QRW EH FRQVWUXHG WR OLPLW WKH &RQVXOWDQW¶V REOLJDWLRQV XQGHU WKLV $JUHHPHQW LQFOXGLQJ ,QGHPQLW\ $GGLWLRQDO&RYHUDJH7RWKHH[WHQWWKDWLQVXUDQFHFRYHUDJHSURYLGHGE\&RQVXOWDQW PDLQWDLQVKLJKHUOLPLWVWKDQWKHPLQLPXPVDSSHDULQJLQ([KLELW%&LW\UHTXLUHVDQGVKDOOEH HQWLWOHGWRFRYHUDJHIRUKLJKHUOLPLWVPDLQWDLQHG ,1'(01,),&$7,21 *HQHUDO7RWKHPD[LPXPH[WHQWDOORZHGE\ODZ&RQVXOWDQWVKDOOWLPHO\DQGIXOO\ SURWHFW GHIHQG UHLPEXUVH LQGHPQLI\ DQG KROG KDUPOHVV &LW\ LWV HOHFWHG DQG DSSRLQWHG RIILFHUVDJHQWVHPSOR\HHVDQGYROXQWHHUVFROOHFWLYHO\³,QGHPQLILHG3DUWLHV´IURPDQG DJDLQVWDQ\DQGDOOFODLPVGHPDQGVFDXVHVRIDFWLRQFRVWVH[SHQVHVLQFOXGLQJUHDVRQDEOH DWWRUQH\V¶IHHVDQGFRXUWFRVWVOLDELOLW\ORVVGDPDJHRULQMXU\LQODZRUHTXLW\WRSURSHUW\ RUSHUVRQVLQFOXGLQJZURQJIXOGHDWKLQDQ\PDQQHUDULVLQJRXWRIRULQFLGHQWWRDQ\DOOHJHG DFWV RPLVVLRQV QHJOLJHQFH RUZLOOIXO PLVFRQGXFW RI &RQVXOWDQW LWV RIILFLDOV RIILFHUV HPSOR\HHVDJHQWVDQGFRQWUDFWRUVDULVLQJRXWRIRULQFRQQHFWLRQZLWKWKHSHUIRUPDQFHRIWKH 5HTXLUHG 6HUYLFHV WKH UHVXOWV RI VXFK SHUIRUPDQFH RU WKLV $JUHHPHQW 7KLV LQGHPQLW\ SURYLVLRQGRHVQRWLQFOXGHDQ\FODLPVGDPDJHVOLDELOLW\FRVWVDQGH[SHQVHVDULVLQJIURPWKH VROHQHJOLJHQFHRUZLOOIXOPLVFRQGXFWRIWKH,QGHPQLILHG3DUWLHV$OVRFRYHUHGLVOLDELOLW\ DULVLQJIURPFRQQHFWHGZLWKFDXVHGE\RUFODLPHGWREHFDXVHGE\WKHDFWLYHRUSDVVLYH QHJOLJHQWDFWVRURPLVVLRQVRIWKH,QGHPQLILHG3DUWLHVZKLFKPD\EHLQFRPELQDWLRQZLWKWKH DFWLYHRUSDVVLYHQHJOLJHQWDFWVRURPLVVLRQVRIWKH&RQVXOWDQWLWVHPSOR\HHVDJHQWVRU RIILFHUVRUDQ\WKLUGSDUW\ Page 503 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϯͮWĂŐĞ 0RGLILHG ,QGHPQLW\ :KHUH $JUHHPHQW ,QYROYHV 'HVLJQ 3URIHVVLRQDO 6HUYLFHV 1RWZLWKVWDQGLQJ WKH IRUJRLQJ LI WKH VHUYLFHV SURYLGHG XQGHU WKLV$JUHHPHQWDUHGHVLJQ SURIHVVLRQDOVHUYLFHVDVGHILQHGE\&DOLIRUQLD&LYLO&RGHVHFWLRQDVPD\EHDPHQGHG IURPWLPHWRWLPHWKHGHIHQVHDQGLQGHPQLW\REOLJDWLRQXQGHU6HFWLRQDERYHVKDOOEHOLPLWHG WRWKHH[WHQWUHTXLUHGE\&DOLIRUQLD&LYLO&RGHVHFWLRQ &RVWVRI'HIHQVHDQG$ZDUG,QFOXGHGLQ&RQVXOWDQW¶VREOLJDWLRQVXQGHUWKLV6HFWLRQ LV&RQVXOWDQW¶VREOLJDWLRQWRGHIHQGDW&RQVXOWDQW¶VRZQFRVWH[SHQVHDQGULVNDQGZLWK FRXQVHODSSURYHGLQZULWLQJE\&LW\DQ\DQGDOOVXLWVDFWLRQVRURWKHUOHJDOSURFHHGLQJVWKDW PD\EHEURXJKWRULQVWLWXWHGDJDLQVWRQHRUPRUHRIWKH,QGHPQLILHG3DUWLHV6XEMHFWWRWKH OLPLWDWLRQVLQWKLV6HFWLRQ&RQVXOWDQWVKDOOSD\DQGVDWLVI\DQ\MXGJPHQWDZDUGRUGHFUHH WKDWPD\EHUHQGHUHGDJDLQVWRQHRUPRUHRIWKH,QGHPQLILHG3DUWLHVIRUDQ\DQGDOOUHODWHG OHJDOH[SHQVHVDQGFRVWVLQFXUUHGE\DQ\RIWKHP &RQVXOWDQW¶V2EOLJDWLRQV1RW/LPLWHGRU0RGLILHG&RQVXOWDQW¶VREOLJDWLRQVXQGHUWKLV 6HFWLRQVKDOOQRWEHOLPLWHGWRLQVXUDQFHSURFHHGVLIDQ\UHFHLYHGE\WKH,QGHPQLILHG3DUWLHV RUE\ DQ\SULRU RU VXEVHTXHQW GHFODUDWLRQE\WKH&RQVXOWDQW )XUWKHUPRUH &RQVXOWDQW¶V REOLJDWLRQVXQGHUWKLV6HFWLRQVKDOOLQQRZD\OLPLWPRGLI\RUH[FXVHDQ\RI&RQVXOWDQW¶V RWKHUREOLJDWLRQVRUGXWLHVXQGHUWKLV$JUHHPHQW (QIRUFHPHQW&RVWV&RQVXOWDQWDJUHHVWRSD\DQ\DQGDOOFRVWVDQGIHHV&LW\LQFXUVLQ HQIRUFLQJ&RQVXOWDQW¶VREOLJDWLRQVXQGHUWKLV6HFWLRQ 6XUYLYDO&RQVXOWDQW¶VREOLJDWLRQVXQGHUWKLV6HFWLRQVKDOOVXUYLYHWKHWHUPLQDWLRQRI WKLV$JUHHPHQW ),1$1&,$/,17(5(6762)&2168/7$17 )RUP)LOLQJ7KH&DOLIRUQLD3ROLWLFDO5HIRUP$FWDQGWKH&KXOD9LVWD&RQIOLFWRI ,QWHUHVW &RGH UHTXLUH FHUWDLQJRYHUQPHQW RIILFLDOV DQG FRQVXOWDQWV SHUIRUPLQJ ZRUN IRU JRYHUQPHQWDJHQFLHVWRSXEOLFO\GLVFORVHFHUWDLQRIWKHLUSHUVRQDODVVHWVDQGLQFRPHXVLQJD 6WDWHPHQWRI(FRQRPLF,QWHUHVWVIRUP)RUP,QRUGHUWRDVVXUHFRPSOLDQFHZLWKWKHVH UHTXLUHPHQWV &RQVXOWDQW VKDOO FRPSO\ ZLWK WKH GLVFORVXUH UHTXLUHPHQWV LGHQWLILHG LQ WKH DWWDFKHG([KLELW&LQFRUSRUDWHGLQWRWKH$JUHHPHQWE\WKLVUHIHUHQFH 'LVFORVXUHV3URKLELWHG,QWHUHVWV,QGHSHQGHQWRIZKHWKHU&RQVXOWDQWLVUHTXLUHGWRILOH D)RUP&RQVXOWDQWZDUUDQWVDQGUHSUHVHQWVWKDWLWKDVGLVFORVHGWR&LW\DQ\HFRQRPLF LQWHUHVWVKHOGE\&RQVXOWDQWRULWVHPSOR\HHVRUVXEFRQWUDFWRUVZKRZLOOEHSHUIRUPLQJWKH 5HTXLUHG6HUYLFHVLQDQ\UHDOSURSHUW\RUSURMHFWZKLFKLVWKHVXEMHFWRIWKLV$JUHHPHQW &RQVXOWDQWZDUUDQWVDQGUHSUHVHQWVWKDWLWKDVQRWHPSOR\HGRUUHWDLQHGDQ\FRPSDQ\RUSHUVRQ RWKHUWKDQDERQDILGHHPSOR\HHRUDSSURYHGVXEFRQWUDFWRUZRUNLQJVROHO\IRU&RQVXOWDQWWR VROLFLWRUVHFXUHWKLV$JUHHPHQW)XUWKHU&RQVXOWDQWZDUUDQWVDQGUHSUHVHQWVWKDWLWKDVQRW SDLGRUDJUHHGWRSD\DQ\FRPSDQ\RUSHUVRQRWKHUWKDQDERQDILGHHPSOR\HHRUDSSURYHG VXEFRQWUDFWRUZRUNLQJVROHO\IRU&RQVXOWDQWDQ\IHHFRPPLVVLRQSHUFHQWDJHEURNHUDJHIHH Page 504 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϰͮWĂŐĞ JLIWRURWKHUFRQVLGHUDWLRQFRQWLQJHQWXSRQRUUHVXOWLQJIURPWKHDZDUGRUPDNLQJRIWKLV $JUHHPHQW&RQVXOWDQWIXUWKHUZDUUDQWVDQGUHSUHVHQWVWKDWQRRIILFHURUHPSOR\HHRI&LW\KDV DQ\LQWHUHVWZKHWKHUFRQWUDFWXDOQRQFRQWUDFWXDOILQDQFLDORURWKHUZLVHLQWKLVWUDQVDFWLRQ WKH SURFHHGV KHUHRI RU LQ WKH EXVLQHVV RI &RQVXOWDQW RU &RQVXOWDQW¶V VXEFRQWUDFWRUV &RQVXOWDQWIXUWKHUDJUHHVWRQRWLI\&LW\LQWKHHYHQWDQ\VXFKLQWHUHVWLVGLVFRYHUHGZKHWKHURU QRWVXFKLQWHUHVWLVSURKLELWHGE\ODZRUWKLV$JUHHPHQW)RUEUHDFKRUYLRODWLRQRIDQ\RIWKHVH ZDUUDQWLHV&LW\VKDOOKDYHWKHULJKWWRUHVFLQGWKLV$JUHHPHQWZLWKRXWOLDELOLW\ 5(0(',(6 7HUPLQDWLRQIRU&DXVH,IIRUDQ\UHDVRQZKDWVRHYHU&RQVXOWDQWVKDOOIDLOWRSHUIRUP WKH5HTXLUHG6HUYLFHVXQGHUWKLV$JUHHPHQWLQDSURSHURUWLPHO\PDQQHURULI&RQVXOWDQW VKDOOYLRODWHDQ\RIWKHRWKHUFRYHQDQWVDJUHHPHQWVRUFRQGLWLRQVRIWKLV$JUHHPHQWHDFKD ³'HIDXOW´LQDGGLWLRQWRDQ\DQGDOORWKHUULJKWVDQGUHPHGLHV&LW\PD\KDYHXQGHUWKLV $JUHHPHQWDWODZRULQHTXLW\&LW\VKDOOKDYHWKHULJKWWRWHUPLQDWHWKLV$JUHHPHQWE\JLYLQJ ILYHGD\VZULWWHQQRWLFHWR&RQVXOWDQW6XFKQRWLFHVKDOOLGHQWLI\WKH'HIDXOWDQGWKH $JUHHPHQWWHUPLQDWLRQGDWH,I&RQVXOWDQWQRWLILHV&LW\RILWVLQWHQWWRFXUHVXFK'HIDXOWSULRU WR&LW\¶VVSHFLILHGWHUPLQDWLRQGDWHDQG&LW\DJUHHVWKDWWKHVSHFLILHG'HIDXOWLVFDSDEOHRI EHLQJFXUHG&LW\PD\JUDQW&RQVXOWDQWXSWRWHQDGGLWLRQDOGD\VDIWHUWKHGHVLJQDWHG WHUPLQDWLRQGDWHWRHIIHFWXDWHVXFKFXUH,QWKHHYHQWRIDWHUPLQDWLRQXQGHUWKLV6HFWLRQ &RQVXOWDQWVKDOOLPPHGLDWHO\SURYLGH&LW\DQ\DQGDOO´:RUN3URGXFW´GHILQHGLQ6HFWLRQ EHORZSUHSDUHGE\&RQVXOWDQWDVSDUWRIWKH5HTXLUHG6HUYLFHV6XFK:RUN3URGXFWVKDOOEH &LW\¶VVROHDQGH[FOXVLYHSURSHUW\DVSURYLGHGLQ6HFWLRQKHUHRI&RQVXOWDQWPD\EHHQWLWOHG WRFRPSHQVDWLRQIRUZRUNVDWLVIDFWRULO\SHUIRUPHGSULRUWR&RQVXOWDQW¶VUHFHLSWRIWKH'HIDXOW QRWLFHSURYLGHGKRZHYHULQQRHYHQWVKDOOVXFKFRPSHQVDWLRQH[FHHGWKHDPRXQWWKDWZRXOG KDYHEHHQSD\DEOHXQGHUWKLV$JUHHPHQWIRUVXFKZRUNDQGDQ\VXFKFRPSHQVDWLRQVKDOOEH UHGXFHGE\DQ\FRVWVLQFXUUHGRUSURMHFWHGWREHLQFXUUHGE\&LW\DVDUHVXOWRIWKH'HIDXOW 7HUPLQDWLRQRU6XVSHQVLRQIRU&RQYHQLHQFHRI&LW\&LW\PD\VXVSHQGRUWHUPLQDWH WKLV$JUHHPHQWRUDQ\SRUWLRQRIWKH5HTXLUHG6HUYLFHVDWDQ\WLPHDQGIRUDQ\UHDVRQZLWK RU ZLWKRXW FDXVH E\ JLYLQJ VSHFLILF ZULWWHQ QRWLFH WR &RQVXOWDQW RI VXFK WHUPLQDWLRQ RU VXVSHQVLRQDWOHDVWILIWHHQGD\VSULRUWRWKHHIIHFWLYHGDWHWKHUHRI8SRQUHFHLSWRIVXFK QRWLFH&RQVXOWDQWVKDOOLPPHGLDWHO\FHDVHDOOZRUNXQGHUWKH$JUHHPHQWDQGSURPSWO\GHOLYHU DOO³:RUN3URGXFW´GHILQHGLQ6HFWLRQEHORZWR&LW\6XFK:RUN3URGXFWVKDOOEH&LW\ V VROHDQGH[FOXVLYHSURSHUW\DVSURYLGHGLQ6HFWLRQKHUHRI&RQVXOWDQWVKDOOEHHQWLWOHGWR UHFHLYHMXVWDQGHTXLWDEOHFRPSHQVDWLRQIRUWKLV:RUN3URGXFWLQDQDPRXQWHTXDOWRWKH DPRXQWGXHDQGSD\DEOHXQGHUWKLV$JUHHPHQWIRUZRUNVDWLVIDFWRULO\SHUIRUPHGDVRIWKHGDWH RI WKH WHUPLQDWLRQVXVSHQVLRQ QRWLFH SOXV DQ\ DGGLWLRQDO UHPDLQLQJ 5HTXLUHG 6HUYLFHV UHTXHVWHG RU DSSURYHG E\ &LW\ LQDGYDQFH WKDW ZRXOG PD[LPL]H &LW\¶V YDOXH XQGHU WKH $JUHHPHQW :DLYHURI&ODLPV,QWKHHYHQW&LW\WHUPLQDWHVWKH$JUHHPHQWLQDFFRUGDQFHZLWKWKH WHUPVRIWKLV6HFWLRQ&RQVXOWDQWKHUHE\H[SUHVVO\ZDLYHVDQ\DQGDOOFODLPVIRUGDPDJHVRU FRPSHQVDWLRQDVDUHVXOWRIVXFKWHUPLQDWLRQH[FHSWDVH[SUHVVO\SURYLGHGLQWKLV6HFWLRQ Page 505 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϱͮWĂŐĞ $GPLQLVWUDWLYH&ODLPV5HTXLUHPHQWVDQG3URFHGXUHV1RVXLWRUDUELWUDWLRQVKDOOEH EURXJKWDULVLQJRXWRIWKLV$JUHHPHQWDJDLQVW&LW\XQOHVVDFODLPKDVILUVWEHHQSUHVHQWHGLQ ZULWLQJDQGILOHGZLWK&LW\DQGDFWHGXSRQE\&LW\LQDFFRUGDQFHZLWKWKHSURFHGXUHVVHWIRUWK LQ&KDSWHURIWKH&KXOD9LVWD0XQLFLSDO&RGHDVVDPHPD\EHDPHQGHGWKHSURYLVLRQV RIZKLFKLQFOXGLQJVXFKSROLFLHVDQGSURFHGXUHVXVHGE\&LW\LQWKHLPSOHPHQWDWLRQRIVDPH DUHLQFRUSRUDWHGKHUHLQE\WKLVUHIHUHQFH8SRQUHTXHVWE\&LW\&RQVXOWDQWVKDOOPHHWDQG FRQIHULQJRRGIDLWKZLWK&LW\IRUWKHSXUSRVHRIUHVROYLQJDQ\GLVSXWHRYHUWKHWHUPVRIWKLV $JUHHPHQW *RYHUQLQJ /DZ9HQXH 7KLV $JUHHPHQW VKDOO EH JRYHUQHG E\ DQG FRQVWUXHG LQ DFFRUGDQFHZLWKWKHODZVRIWKH6WDWHRI&DOLIRUQLD$Q\DFWLRQDULVLQJXQGHURUUHODWLQJWRWKLV $JUHHPHQWVKDOOEHEURXJKWRQO\LQ6DQ'LHJR&RXQW\6WDWHRI&DOLIRUQLD 6HUYLFH RI 3URFHVV &RQVXOWDQW DJUHHV WKDW LW LV VXEMHFW WRSHUVRQDOMXULVGLFWLRQLQ &DOLIRUQLD,I&RQVXOWDQWLVDIRUHLJQFRUSRUDWLRQOLPLWHGOLDELOLW\FRPSDQ\RUSDUWQHUVKLSWKDW LVQRWUHJLVWHUHGZLWKWKH&DOLIRUQLD6HFUHWDU\RI6WDWH&RQVXOWDQWLUUHYRFDEO\FRQVHQWVWR VHUYLFHRISURFHVVRQ&RQVXOWDQWE\ILUVWFODVVPDLOGLUHFWHGWRWKHLQGLYLGXDODQGDGGUHVVOLVWHG XQGHU³)RU/HJDO1RWLFH´LQVHFWLRQ%RI([KLELW$WRWKLV$JUHHPHQWDQGWKDWVXFKVHUYLFH VKDOOEHHIIHFWLYHILYHGD\VDIWHUPDLOLQJ 2:1(56+,3$1'86(2):25.352'8&7 $OOUHSRUWVVWXGLHVLQIRUPDWLRQGDWDVWDWLVWLFVIRUPVGHVLJQVSODQVSURFHGXUHVV\VWHPV DQGDQ\RWKHUPDWHULDOVRUSURSHUWLHVSURGXFHGLQZKROHRULQSDUWXQGHUWKLV$JUHHPHQWLQ FRQQHFWLRQZLWKWKHSHUIRUPDQFHRIWKH5HTXLUHG6HUYLFHVFROOHFWLYHO\³:RUN3URGXFW´VKDOO EHWKHVROHDQGH[FOXVLYHSURSHUW\RI&LW\1RVXFK:RUN3URGXFWVKDOOEHVXEMHFWWRSULYDWH XVHFRS\ULJKWVRUSDWHQWULJKWVE\&RQVXOWDQWLQWKH8QLWHG6WDWHVRULQDQ\RWKHUFRXQWU\ ZLWKRXWWKHH[SUHVVSULRUZULWWHQFRQVHQWRI&LW\&LW\VKDOOKDYHXQUHVWULFWHGDXWKRULW\WR SXEOLVKGLVFORVHGLVWULEXWHDQGRWKHUZLVHXVHFRS\ULJKWRUSDWHQWLQZKROHRULQSDUWDQ\ VXFK:RUN3URGXFWZLWKRXWUHTXLULQJDQ\SHUPLVVLRQRI&RQVXOWDQWH[FHSWDVPD\EHOLPLWHG E\WKHSURYLVLRQVRIWKH3XEOLF5HFRUGV$FWRUH[SUHVVO\SURKLELWHGE\RWKHUDSSOLFDEOHODZV :LWKUHVSHFWWRFRPSXWHUILOHVFRQWDLQLQJGDWDJHQHUDWHGDV:RUN3URGXFW&RQVXOWDQWVKDOO PDNHDYDLODEOHWR&LW\XSRQUHDVRQDEOHZULWWHQUHTXHVWE\&LW\WKHQHFHVVDU\IXQFWLRQDO FRPSXWHU VRIWZDUH DQG KDUGZDUH IRU SXUSRVHV RI DFFHVVLQJ FRPSLOLQJ WUDQVIHUULQJ DQG SULQWLQJFRPSXWHUILOHV *(1(5$/3529,6,216 $PHQGPHQW7KLV$JUHHPHQWPD\EHDPHQGHGEXWRQO\LQZULWLQJVLJQHGE\ERWK 3DUWLHV Page 506 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϲͮWĂŐĞ $VVLJQPHQW&LW\ZRXOGQRWKDYHHQWHUHGLQWRWKLV$JUHHPHQWEXWIRU&RQVXOWDQW¶V XQLTXHTXDOLILFDWLRQVDQGWUDLWV&RQVXOWDQWVKDOOQRWDVVLJQDQ\RILWVULJKWVRUUHVSRQVLELOLWLHV XQGHUWKLV$JUHHPHQWQRUDQ\SDUWKHUHRIZLWKRXW&LW\¶VSULRUZULWWHQFRQVHQWZKLFK&LW\ PD\JUDQWFRQGLWLRQRUGHQ\LQLWVVROHGLVFUHWLRQ $XWKRULW\ 7KH SHUVRQV H[HFXWLQJ WKLV $JUHHPHQW IRU &RQVXOWDQW ZDUUDQWV DQG UHSUHVHQWVWKDWWKH\KDYHWKHDXWKRULW\WRH[HFXWHVDPHRQEHKDOIRI&RQVXOWDQWDQGWRELQG &RQVXOWDQWWRLWVREOLJDWLRQVKHUHXQGHUZLWKRXWDQ\IXUWKHUDFWLRQRUGLUHFWLRQIURP&RQVXOWDQW RUDQ\ERDUGSULQFLSOHRURIILFHUWKHUHRI &RXQWHUSDUWV7KLV$JUHHPHQWPD\EHH[HFXWHGLQFRXQWHUSDUWVHDFKRIZKLFKVKDOO EHGHHPHGDQRULJLQDOEXWDOORIZKLFKVKDOOFRQVWLWXWHRQH$JUHHPHQWDIWHUHDFK3DUW\KDV VLJQHGVXFKDFRXQWHUSDUW (QWLUH$JUHHPHQW7KLV$JUHHPHQWWRJHWKHUZLWKDOOH[KLELWVDWWDFKHGKHUHWRDQGRWKHU DJUHHPHQWVH[SUHVVO\UHIHUUHGWRKHUHLQFRQVWLWXWHVWKHHQWLUH$JUHHPHQWEHWZHHQWKH3DUWLHV ZLWKUHVSHFWWRWKHVXEMHFWPDWWHUFRQWDLQHGKHUHLQ$OOH[KLELWVUHIHUHQFHGKHUHLQVKDOOEH DWWDFKHG KHUHWR DQG DUH LQFRUSRUDWHG KHUHLQ E\ UHIHUHQFH $OOSULRU RU FRQWHPSRUDQHRXV DJUHHPHQWVXQGHUVWDQGLQJVUHSUHVHQWDWLRQVZDUUDQWLHVDQGVWDWHPHQWVRUDORUZULWWHQDUH VXSHUVHGHG 5HFRUG5HWHQWLRQ'XULQJWKHFRXUVHRIWKH$JUHHPHQWDQGIRUWKUHH\HDUVIROORZLQJ FRPSOHWLRQ RI WKH 5HTXLUHG 6HUYLFHV &RQVXOWDQW DJUHHV WR PDLQWDLQ LQWDFW DQG UHDGLO\ DFFHVVLEOHDOOGDWDGRFXPHQWVUHSRUWVUHFRUGVFRQWUDFWVDQGVXSSRUWLQJPDWHULDOVUHODWLQJWR WKHSHUIRUPDQFHRIWKH$JUHHPHQWLQFOXGLQJDFFRXQWLQJIRUFRVWVDQGH[SHQVHVFKDUJHGWR &LW\LQFOXGLQJVXFKUHFRUGVLQWKHSRVVHVVLRQRIVXEFRQWUDFWRUVVXEFRQVXOWDQWV )XUWKHU$VVXUDQFHV7KH3DUWLHVDJUHHWRSHUIRUPVXFKIXUWKHUDFWVDQGWRH[HFXWH DQGGHOLYHUVXFKDGGLWLRQDOGRFXPHQWVDQGLQVWUXPHQWVDVPD\EHUHDVRQDEO\UHTXLUHGLQ RUGHUWRFDUU\RXWWKHSURYLVLRQVRIWKLV$JUHHPHQWDQGWKHLQWHQWLRQVRIWKH3DUWLHV ,QGHSHQGHQW&RQWUDFWRU&RQVXOWDQWLVDQGVKDOODWDOOWLPHVUHPDLQDVWR&LW\DZKROO\ LQGHSHQGHQWFRQWUDFWRU1HLWKHU&LW\QRUDQ\RILWVRIILFHUVHPSOR\HHVDJHQWVRUYROXQWHHUV VKDOOKDYHFRQWURORYHUWKHFRQGXFWRI&RQVXOWDQWRUDQ\RI&RQVXOWDQW¶VRIILFHUVHPSOR\HHV RU DJHQWV ³&RQVXOWDQW5HODWHG ,QGLYLGXDOV´ H[FHSW DV VHW IRUWKLQWKLV$JUHHPHQW1R &RQVXOWDQW5HODWHG,QGLYLGXDOVVKDOOEHGHHPHGHPSOR\HHVRI&LW\DQGQRQHRIWKHPVKDOOEH HQWLWOHGWRDQ\EHQHILWVWRZKLFK&LW\HPSOR\HHVDUHHQWLWOHGLQFOXGLQJEXWQRWOLPLWHGWR RYHUWLPHUHWLUHPHQWEHQHILWVZRUNHU VFRPSHQVDWLRQEHQHILWVLQMXU\OHDYHRURWKHUOHDYH EHQHILWV)XUWKHUPRUH&LW\ZLOOQRWZLWKKROGVWDWHRUIHGHUDOLQFRPHWD[VRFLDOVHFXULW\WD[ RUDQ\RWKHUSD\UROOWD[ZLWKUHVSHFWWRDQ\&RQVXOWDQW5HODWHG,QGLYLGXDOVLQVWHDG&RQVXOWDQW VKDOOEHVROHO\UHVSRQVLEOHIRUWKHSD\PHQWRIVDPHDQGVKDOOKROGWKH&LW\KDUPOHVVZLWK UHVSHFWWRVDPH&RQVXOWDQWVKDOOQRWDWDQ\WLPHRULQDQ\PDQQHUUHSUHVHQWWKDWLWRUDQ\RI LWV&RQVXOWDQW5HODWHG,QGLYLGXDOVDUHHPSOR\HHVRUDJHQWVRI&LW\&RQVXOWDQWVKDOOQRWLQFXU Page 507 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϳͮWĂŐĞ RUKDYHWKHSRZHUWRLQFXUDQ\GHEWREOLJDWLRQRUOLDELOLW\ZKDWVRHYHUDJDLQVW&LW\RUELQG &LW\LQDQ\PDQQHU 1RWLFHV $OO QRWLFHV GHPDQGV RU UHTXHVWV SURYLGHG IRU RUSHUPLWWHGWREHJLYHQ SXUVXDQWWRWKLV$JUHHPHQWPXVWEHLQZULWLQJ$OOQRWLFHVGHPDQGVDQGUHTXHVWVWREHVHQW WRDQ\3DUW\VKDOOEHGHHPHGWRKDYHEHHQSURSHUO\JLYHQRUVHUYHGLISHUVRQDOO\VHUYHGRU GHSRVLWHGLQWKH8QLWHG6WDWHVPDLODGGUHVVHGWRVXFK3DUW\SRVWDJHSUHSDLGUHJLVWHUHGRU FHUWLILHGZLWKUHWXUQUHFHLSWUHTXHVWHGDWWKHDGGUHVVHVLGHQWLILHGLQWKLV$JUHHPHQWDWWKH SODFHVRIEXVLQHVVIRUHDFKRIWKHGHVLJQDWHG3DUWLHVDVLQGLFDWHGLQ([KLELW$RURWKHUZLVH SURYLGHGLQZULWLQJ (OHFWURQLF6LJQDWXUHV(DFK3DUW\DJUHHVWKDWWKHHOHFWURQLFVLJQDWXUHVZKHWKHUGLJLWDO RUHQFU\SWHGRIWKH3DUWLHVLQFOXGHGLQWKLV$JUHHPHQWDUHLQWHQGHGWRDXWKHQWLFDWHWKLVZULWLQJ DQGWRKDYHWKHVDPHIRUFHDQGHIIHFWDVPDQXDOVLJQDWXUHV(OHFWURQLF6LJQDWXUHPHDQVDQ\ HOHFWURQLFVRXQGV\PERORUSURFHVVDWWDFKHGWRRUORJLFDOO\DVVRFLDWHGZLWKDUHFRUGDQG H[HFXWHGDQGDGRSWHGE\D3DUW\ZLWKWKHLQWHQWWRVLJQVXFKUHFRUGLQFOXGLQJIDFVLPLOHRU HPDLOHOHFWURQLFVLJQDWXUHVSXUVXDQWWRWKH&DOLIRUQLD8QLIRUP(OHFWURQLF7UDQVDFWLRQV$FW &DO&LY&RGHWRDVDPHQGHGIURPWLPHWRWLPH (QGRISDJH1H[WSDJHLVVLJQDWXUHSDJH Page 508 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϴͮWĂŐĞ 6,*1$785(3$*( &2168/7$176(59,&(6$*5((0(17 ,1:,71(66:+(5(2)E\H[HFXWLQJWKLV$JUHHPHQWZKHUHLQGLFDWHGEHORZ&LW\DQG &RQVXOWDQWDJUHHWKDWWKH\KDYHUHDGDQGXQGHUVWRRGDOOWHUPVDQGFRQGLWLRQVRIWKH$JUHHPHQW WKDWWKH\IXOO\DJUHHDQGFRQVHQWWRERXQGE\VDPHDQGWKDWWKH\DUHIUHHO\HQWHULQJLQWRWKLV $JUHHPHQWDVRIWKH(IIHFWLYH'DWH &,7<2)&+8/$9,67$ &,7<2)&+8/$9,67$ %<BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB %<BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB (QWHU1DPH2I6LJQDWRU\&KRRVHDVLJQDWRU\ (QWHU7LWOH2I6LJQDWRU\&KRRVHWKHVLJQDWRU\¶VWLWOH $77(67 %< BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB .HUU\.%LJHORZ00& &LW\&OHUN $33529('$672)250 &,7<$77251(< %< BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBSULQWHGQDPH BBBBBBBBB $WWHVWDWLRQVLJQDWXUHRQO\UHTXLUHGLIWKH0D\RUVLJQVWKH$JUHHPHQW,I0D\RULVQRWVLJQLQJDJUHHPHQWGHOHWH HQWLUHDWWHVWDWLRQVLJQDWXUHEORFN Page 509 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϮϵͮWĂŐĞ (;+,%,7$ 6&23(2):25.$1'3$<0(177(506 ,16758&7,216 (17(5 ,1)250$7,21 $6 5(48(67(' )25 6(&7,216 7+$7 3529,'( 237,216 6(/(&7 7+( &255(&7 237,21 ,) <28 :,6+ 72 $77$&+ $'',7,21$/,1)250$7,215(/$7('72(;+,%,7$3/($6($77$&+$1'/$%(/ $6(;+,%,7$$77$&+0(17(7&'(/(7(237,2161276(/(&7('$1' $//,16758&7,216 &RQWDFW3HRSOHIRU&RQWUDFW$GPLQLVWUDWLRQDQG/HJDO1RWLFH $ &LW\&RQWUDFW$GPLQLVWUDWLRQ (QWHU&LW\6WDII3HUVRQ1DPH (QWHU0DLOLQJ$GGUHVV (QWHU3KRQH1XPEHU (QWHU(PDLO$GGUHVV )RU/HJDO1RWLFH&RS\WR &LW\RI&KXOD9LVWD &LW\$WWRUQH\ )RXUWK$YHQXH&KXOD9LVWD&$ &LW\$WWRUQH\#FKXODYLVWDFDJRY % &RQVXOWDQW&RQWUDFW$GPLQLVWUDWLRQ &,7<2)&+8/$9,67$ (QWHU0DLOLQJ$GGUHVV (QWHU3KRQH1XPEHU (QWHU(PDLO$GGUHVV )RU/HJDO1RWLFH&RS\WR (QWHU&RQVXOWDQW6WDII3HUVRQ1DPH (QWHU0DLOLQJ$GGUHVV (QWHU3KRQH1XPEHU (QWHU(PDLO$GGUHVV 5HTXLUHG6HUYLFHV $ *HQHUDO'HVFULSWLRQ (QWHU6XPPDU\2I:RUN7R%H3HUIRUPHGHJ&RQVXOWDQW;<=:LOO3URYLGH&XVWRPHU 6HUYLFH7UDLQLQJV7R&LW\6WDII % 'HWDLOHG'HVFULSWLRQ Page 510 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϯϬͮWĂŐĞ (QWHU'HWDLOHG,QIRUPDWLRQ$ERXW(DFK7DVN7R%H3HUIRUPHG,QFOXGLQJ7DVN'HVFULSWLRQ $VVRFLDWHG'HOLYHUDEOHV$QG&RPSOHWLRQ'DWH0D\%H:ULWWHQ$V1DUUDWLYH2U7DEOH$V ,OOXVWUDWHG%HORZ'HOHWH7DEOH,I1RW8VHG 7DVN 'HVFULSWLRQ 'HOLYHUDEOHV &RPSOHWLRQ'DWH ([DPSOH&RQGXFWWUDLQLQJVIRU &LW\VWDII 3URYLGHFRS\RIWUDLQLQJ PDWHULDOVVLJQLQVKHHW DQGOLVWRIDJUHHGXSRQ QH[WVWHSV (QWHU$GGLWLRQDO/LQHV)RU 7DVNV$V1HHGHG'HOHWH ([FHVV/LQHV 7HUP,QDFFRUGDQFHZLWK6HFWLRQRIWKLV$JUHHPHQWWKHWHUPRIWKLV$JUHHPHQWVKDOO EHJLQ(QWHU'DWHDQGHQGRQ(QWHU'DWHIRUFRPSOHWLRQRIDOO5HTXLUHG6HUYLFHV &RPSHQVDWLRQ6(/(&721(2)7+()2//2:,1*237,2167+(1'(/(7( $1<237,217+$7,6127$33/,&$%/($6:(//$67+(6(,16758&7,216 $ )RUPRI&RPSHQVDWLRQ ܆6LQJOH)L[HG)HH)RUSHUIRUPDQFHRIDOORIWKH5HTXLUHG6HUYLFHVE\&RQVXOWDQWDVKHUHLQ UHTXLUHG&LW\VKDOOSD\DVLQJOHIL[HGIHHRI(QWHU&RQWUDFW$PRXQWXSRQFRPSOHWLRQRIDOO 5HTXLUHG6HUYLFHVWR&LW\¶VVDWLVIDFWLRQ 25 ܆)L[HG)HH3DLGLQ,QFUHPHQWV)RUWKHFRPSOHWLRQRIHDFK'HOLYHUDEOHRIWKH5HTXLUHG6HUYLFHV DVLGHQWLILHGLQVHFWLRQ%DERYH&LW\VKDOOSD\WKHIL[HGIHHDVVRFLDWHGZLWKHDFK'HOLYHUDEOH LQWKHDPRXQWVVHWIRUWKEHORZ 7DVN1R 'HOLYHUDEOH $PRXQW 25 ܆7LPHDQG0DWHULDOV)RUSHUIRUPDQFHRIWKH5HTXLUHG6HUYLFHVE\&RQVXOWDQWDVLGHQWLILHGLQ 6HFWLRQ%DERYH&LW\VKDOOSD\&RQVXOWDQWIRUWKHSURGXFWLYHKRXUVRIWLPHVSHQWE\&RQVXOWDQW LQWKHSHUIRUPDQFHRIWKH5HTXLUHG6HUYLFHVDWWKHUDWHVRUDPRXQWVDVLQGLFDWHGEHORZ (QWHU$SSOLFDEOH+RXUO\5DWHV Page 511 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϯϭͮWĂŐĞ % 5HLPEXUVHPHQWRI&RVWV ܆1RQHWKHFRPSHQVDWLRQLQFOXGHVDOOFRVWV 25 ܆,QYRLFHGRUDJUHHGXSRQDPRXQWVDVIROORZV (QWHURU$WWDFK$QG5HIHUHQFH$Q\$JUHHG8SRQ&RVW5HLPEXUVHPHQWV 1RWZLWKVWDQGLQJWKHIRUHJRLQJWKHPD[LPXPDPRXQWWREHSDLGWRWKH&RQVXOWDQWIRUVHUYLFHV SHUIRUPHGWKURXJK(QWHU(QGRI&RQWUDFW'DWHVKDOOQRWH[FHHG(QWHU$PRXQW 6SHFLDO3URYLVLRQV&+(&.$1<7+$7$33/<256(/(&7³121(´$1' '(/(7($//,16758&7,216 ܆3HUPLWWHG6XE&RQVXOWDQWV/LVW3HUPLWWHG6XE&RQVXOWDQWVRU,QGLFDWH³1RQH´ ܆6HFXULW\IRU3HUIRUPDQFH6HH&LW\$WWRUQH\RU,QGLFDWH³1RQH´LI1RW$SSOLFDEOH ܆1RWZLWKVWDQGLQJWKHFRPSOHWLRQGDWHVHWIRUWKLQ6HFWLRQDERYH&LW\KDVRSWLRQWRH[WHQGWKLV $JUHHPHQWIRU,QVHUW1XPEHURI7HUPVDGGLWLRQDOWHUPVGHILQHGDVDRQH\HDULQFUHPHQWRU(QWHU D 6SHFLILF 'DWH LI DSSOLFDEOH7KH &LW\ 0DQDJHU RU 'LUHFWRU RI )LQDQFH7UHDVXUHU VKDOO EH DXWKRUL]HGWRH[HUFLVHWKHH[WHQVLRQVRQEHKDOIRIWKH&LW\,IWKH&LW\H[HUFLVHVDQRSWLRQWR H[WHQGHDFKH[WHQVLRQVKDOOEHRQWKHVDPHWHUPVDQGFRQGLWLRQVFRQWDLQHGKHUHLQSURYLGHGWKDW WKHDPRXQWVVSHFLILHGLQ6HFWLRQDERYHPD\EHLQFUHDVHGE\XSWR,QVHUW3HUFHQWDJHRI,QFUHDVH RU$FWXDO'ROODU$PRXQWIRUHDFKH[WHQVLRQ7KH&LW\VKDOOJLYHZULWWHQQRWLFHWR&RQVXOWDQWRI WKH&LW\¶VHOHFWLRQWRH[HUFLVHWKHH[WHQVLRQYLDWKH1RWLFHRI([HUFLVHRI2SWLRQWR([WHQG GRFXPHQW ܆2WKHU'HVFULEH6SHFLDO3URYLVLRQV'HOHWH/LQH,I1RW$SSOLFDEOH ܆1RQH Page 512 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϯϮͮWĂŐĞ (;+,%,7% ,1685$1&(5(48,5(0(176 &RQVXOWDQWVKDOODGKHUHWRDOOWHUPVDQGFRQGLWLRQVRI6HFWLRQRIWKH$JUHHPHQWDQGDJUHHVWR SURYLGHWKHIROORZLQJW\SHVDQGPLQLPXPDPRXQWVRILQVXUDQFHDVLQGLFDWHGE\FKHFNLQJWKH DSSOLFDEOHER[HV[ 7\SHRI,QVXUDQFH 0LQLPXP$PRXQW )RUP ܆*HQHUDO/LDELOLW\ ,QFOXGLQJSURGXFWVDQG FRPSOHWHGRSHUDWLRQV SHUVRQDODQG DGYHUWLVLQJLQMXU\ SHU RFFXUUHQFH IRU ERGLO\ LQMXU\ SHUVRQDO LQMXU\ LQFOXGLQJ GHDWK DQG SURSHUW\ GDPDJH ,I &RPPHUFLDO *HQHUDO /LDELOLW\LQVXUDQFHZLWKDJHQHUDO DJJUHJDWHOLPLWLVXVHGHLWKHUWKH JHQHUDODJJUHJDWHOLPLWPXVWDSSO\ VHSDUDWHO\WRWKLV$JUHHPHQWRUWKH JHQHUDO DJJUHJDWH OLPLW PXVW EH WZLFHWKHUHTXLUHGRFFXUUHQFHOLPLW $GGLWLRQDO,QVXUHG(QGRUVHPHQW RU%ODQNHW$,(QGRUVHPHQWIRU &LW\ :DLYHURI5HFRYHU\(QGRUVHPHQW ,QVXUDQFH6HUYLFHV2IILFH)RUP &* 0XVWEHSULPDU\DQGPXVWQRW H[FOXGH3URGXFWV&RPSOHWHG 2SHUDWLRQV ܆$XWRPRELOH/LDELOLW\ SHUDFFLGHQWIRUERGLO\ LQMXU\ LQFOXGLQJ GHDWK DQG SURSHUW\GDPDJH ,QVXUDQFH6HUYLFHV2IILFH)RUP &$ &RGH$Q\$XWR &RGH+LUHG &RGH1RQ2ZQHG ܆:RUNHUV¶ &RPSHQVDWLRQ (PSOR\HU¶V/LDELOLW\ HDFKDFFLGHQW GLVHDVHSROLF\OLPLW GLVHDVHHDFKHPSOR\HH :DLYHURI5HFRYHU\(QGRUVHPHQW ܆3URIHVVLRQDO/LDELOLW\ (UURUV 2PLVVLRQV HDFKRFFXUUHQFH DJJUHJDWH 2WKHU1HJRWLDWHG,QVXUDQFH7HUPV(17(5$1<$'',7,21$/7(50625³121(´ Page 513 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϯϯͮWĂŐĞ (;+,%,7& &2168/7$17&21)/,&72),17(5(67'(6,*1$7,21 7KH 3ROLWLFDO 5HIRUP $FW DQG WKH &KXOD 9LVWD &RQIOLFW RI ,QWHUHVW &RGH ³&RGH´ UHTXLUH GHVLJQDWHGVWDWHDQGORFDOJRYHUQPHQWRIILFLDOVLQFOXGLQJVRPHFRQVXOWDQWVWRPDNHFHUWDLQSXEOLF GLVFORVXUHVXVLQJD6WDWHPHQWRI(FRQRPLF,QWHUHVWVIRUP)RUP2QFHILOHGD)RUPLV DSXEOLFGRFXPHQWDFFHVVLEOHWRDQ\PHPEHURIWKHSXEOLF,QDGGLWLRQFRQVXOWDQWVGHVLJQDWHGWR ILOHWKH)RUPDUHDOVRUHTXLUHGWRFRPSO\ZLWKFHUWDLQHWKLFVWUDLQLQJUHTXLUHPHQWV ܆$&RQVXOWDQW,6DFRUSRUDWLRQRUOLPLWHGOLDELOLW\FRPSDQ\DQGLVWKHUHIRUH(;&/8'(' IURPGLVFORVXUH ܆%&RQVXOWDQW127DFRUSRUDWLRQRUOLPLWHGOLDELOLW\FRPSDQ\DQGGLVFORVXUHGHVLJQDWLRQLVDV IROORZV $33/,&$%/('(6,*1$7,216)25,1',9,'8$/6$66,*1('723529,'( 6(59,&(6 &DWHJRU\GHVFULSWLRQVDYDLODEOHDWǁǁǁ͘ĐŚƵůĂǀŝƐƚĂĐĂ͘ŐŽǀͬĚĞƉĂƌƚŵĞŶƚƐͬĐŝƚǇͲĐůĞƌŬͬĐŽŶĨůŝĐƚͲŽĨͲ ŝŶƚĞƌĞƐƚͲĐŽĚĞ 1DPH (PDLO$GGUHVV $SSOLFDEOH'HVLJQDWLRQ (QWHU1DPHRI(DFK ,QGLYLGXDO:KR:LOO%H 3URYLGLQJ6HUYLFH8QGHU WKH&RQWUDFW±,I LQGLYLGXDOVKDYHGLIIHUHQW GLVFORVXUHUHTXLUHPHQWV GXSOLFDWHWKLVURZDQG FRPSOHWHVHSDUDWHO\IRU HDFKLQGLYLGXDO (QWHU HPDLO DGGUHVVHV ܆$)XOO'LVFORVXUH ܆%/LPLWHG'LVFORVXUHVHOHFWRQHRU PRUHRIWKHFDWHJRULHVXQGHUZKLFKWKH FRQVXOWDQWVKDOOILOH ܆܆܆܆܆܆ ܆ -XVWLILFDWLRQ ܆&([FOXGHGIURP'LVFORVXUH 5HTXLUHG)LOHUV (DFKLQGLYLGXDOZKRZLOOEHSHUIRUPLQJVHUYLFHVIRUWKH&LW\SXUVXDQWWRWKH$JUHHPHQWDQGZKRPHHWV WKHGHILQLWLRQRI³&RQVXOWDQW´SXUVXDQWWR)33&5HJXODWLRQPXVWILOHD)RUP 5HTXLUHG)LOLQJ'HDGOLQHV (DFKLQLWLDO)RUPUHTXLUHGXQGHUWKLV$JUHHPHQWVKDOOEHILOHGZLWKWKH2IILFHRIWKH&LW\&OHUN YLDWKH&LW\ VRQOLQHILOLQJV\VWHP1HW)LOHZLWKLQGD\VRIWKHDSSURYDORIWKH$JUHHPHQW$GGLWLRQDO )RUPILOLQJVZLOOEHUHTXLUHGDQQXDOO\RQ$SULOGXULQJWKHWHUPRIWKH$JUHHPHQWDQGZLWKLQ GD\VRIWKHWHUPLQDWLRQRIWKH$JUHHPHQW )LOLQJ'HVLJQDWLRQ &DO*RY&RGHHWVHT)33&5HJVDQG &KXOD9LVWD0XQLFLSDO&RGH &DO*RY&RGHHWVHT &$)33&$GY$&KDGZLFN'DYLVY)UHVQR8QLILHG6FKRRO'LVWULFW&DO$SSWK )33&5HJ&RQVXOWDQWGHILQHGDVDQ³LQGLYLGXDO´ZKRSDUWLFLSDWHVLQPDNLQJDJRYHUQPHQWDO GHFLVLRQ³LQGLYLGXDO´GRHVQRWLQFOXGHFRUSRUDWLRQRUOLPLWHGOLDELOLW\FRPSDQ\ Page 514 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Z&WWϭϵͲϮϬϮϯ DĂƌĐŚϭϬ͕ϮϬϮϯ ϯϰͮWĂŐĞ 7KH&LW\'HSDUWPHQW'LUHFWRUZLOOGHVLJQDWHHDFKLQGLYLGXDOZKRZLOOEHSURYLGLQJVHUYLFHVWRWKH&LW\ SXUVXDQWWRWKH$JUHHPHQWDVIXOOGLVFORVXUHOLPLWHGGLVFORVXUHRUH[FOXGHGIURPGLVFORVXUHEDVHGRQ DQDQDO\VLVRIWKHVHUYLFHVWKH&RQVXOWDQWZLOOSURYLGH1RWZLWKVWDQGLQJWKLVGHVLJQDWLRQRUDQ\WKLQJ LQWKH$JUHHPHQWWKH&RQVXOWDQWLVXOWLPDWHO\UHVSRQVLEOHIRUFRPSO\LQJZLWK)33&UHJXODWLRQVDQG ILOLQJUHTXLUHPHQWV,I\RXKDYHDQ\TXHVWLRQVUHJDUGLQJILOLQJUHTXLUHPHQWVSOHDVHGRQRWKHVLWDWHWR FRQWDFWWKH&LW\&OHUNDWRUWKH)33&DW$6.)33&RU 3XUVXDQWWRWKHGXO\DGRSWHG&LW\RI&KXOD9LVWD&RQIOLFWRI,QWHUHVW&RGHWKLVGRFXPHQWVKDOOVHUYHDVWKH ZULWWHQGHWHUPLQDWLRQRIWKHFRQVXOWDQW¶VUHTXLUHPHQWWRFRPSO\ZLWKWKHGLVFORVXUHUHTXLUHPHQWVVHWIRUWKLQ WKH&RGH &RPSOHWHGE\(QWHU&LW\6WDII3HUVRQ¶V1DPH Page 515 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 1 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 CITY OF CHULA VISTA CONTRACTOR/SERVICE PROVIDER SERVICES AGREEMENT WITH PSC INVESTIGATIONS LLC TO PROVIDE BACKGROUND INVESTIGATIVE SERVICES This Agreement is entered into effective as of May 16, 2023(“Effective Date”)by and between the City of Chula Vista, a chartered municipal corporation (“City”) and PSC Investigations LLC, a California limited liability (“Contractor/Service Provider”) (collectively, the “Parties” and, individually, a “Party”) with reference to the following facts: RECITALS WHEREAS, on March 10, 2023, the City of Chula Vista issued Request for Proposal (RFP) # P19-2023 for companies to provide background investigative services for the Police Department; and WHEREAS, Contractor/Service Provider was selected as a result of the RFP process; and WHEREAS, Contractor/Service Provider warrants and represents that it is experienced and staffed in a manner such that it can deliver the services required of Contractor/Service Provider to City in accordance with the time frames and the terms and conditions of this Agreement. [End of Recitals. Next Page Starts Obligatory Provisions.] Page 516 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 2 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 OBLIGATORY PROVISIONS NOW, THEREFORE, in consideration of the above recitals, the covenants contained herein, and other good and valuable consideration, the receipt and sufficiency of which the Parties hereby acknowledge, City and Contractor/Service Provider hereby agree as follows: 1. SERVICES 1.1 Required Services. Contractor/Service Provider agrees to perform the services, and deliver to City the “Deliverables” (if any) described in the attached Exhibit A, incorporated into the Agreement by this reference, within the time frames set forth therein, time being of the essence for this Agreement. The services and/or Deliverables described in Exhibit A shall be referred to herein as the “Required Services.” 1.2 Reductions in Scope of Work. City may independently, or upon request from Contractor/Service Provider, from time to time, reduce the Required Services to be performed by the Contractor/Service Provider under this Agreement. Upon doing so, City and Contractor/Service Provider agree to meet and confer in good faith for the purpose of negotiating a corresponding reduction in the compensation associated with the reduction. 1.3 Additional Services. Subject to compliance with the City’s Charter, codes, policies, procedures and ordinances governing procurement and purchasing authority, City may request Contractor/Service Provider provide additional services related to the Required Services (“Additional Services”). If so, City and Contractor/Service Provider agree to meet and confer in good faith for the purpose of negotiating an amendment to Exhibit A, to add the Additional Services. Unless otherwise agreed, compensation for the Additional Services shall be charged and paid consistent with the rates and terms already provided therein. Once added to Exhibit A, “Additional Services” shall also become “Required Services” for purposes of this Agreement. 1.4 Standard of Care. Contractor/Service Provider expressly warrants and agrees that any and all Required Services hereunder shall be performed in accordance with the highest standard of care exercised by members of the profession currently practicing under similar conditions and in similar locations. 1.5 No Waiver of Standard of Care. Where approval by City is required, it is understood to be conceptual approval only and does not relieve the Contractor/Service Provider of responsibility for complying with all laws, codes, industry standards, and liability for damages caused by negligent acts, errors, omissions, noncompliance with industry standards, or the willful misconduct of the Contractor/Service Provider or its subcontractors. 1.6 Security for Performance. In the event that Exhibit A Section 5 indicates the need for Contractor/Service Provider to provide additional security for performance of its duties under this Agreement, Contractor/Service Provider shall provide such additional security prior to commencement of its Required Services in the form and on the terms prescribed on Exhibit A, or as otherwise prescribed by the City Attorney. 1.7 Compliance with Laws. In its performance of the Required Services, Contractor/Service Provider shall comply with any and all applicable federal, state and local laws, including the Chula Vista Municipal Code. 1.8 Business License. Prior to commencement of work, Contractor/Service Provider shall obtain a business license from City. Page 517 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 3 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 1.9 Subcontractors. Prior to commencement of any work, Contractor/Service Provider shall submit for City’s information and approval a list of any and all subcontractors to be used by Contractor/Service Provider in the performance of the Required Services. Contractor/Service Provider agrees to take appropriate measures necessary to ensure that all subcontractors and personnel utilized by the Contractor/Service Provider to complete its obligations under this Agreement comply with all applicable laws, regulations, ordinances, and policies, whether federal, state, or local. In addition, if any subcontractor is expected to fulfill any responsibilities of the Contractor/Service Provider under this Agreement, Contractor/Service Provider shall ensure that each and every subcontractor carries out the Contractor/Service Provider’s responsibilities as set forth in this Agreement. 1.10 Term. This Agreement shall commence on the earlier to occur of the Effective Date or Contractor/Service Provider’s commencement of the Required Services hereunder, and shall terminate, subject to Sections 6.1 and 6.2 of this Agreement, when the Parties have complied with all their obligations hereunder; provided, however, provisions which expressly survive termination shall remain in effect. 2. COMPENSATION 2.1 General. For satisfactory performance of the Required Services, City agrees to compensate Contractor/Service Provider in the amount(s) and on the terms set forth in Exhibit A, Section 4. Standard terms for billing and payment are set forth in this Section 2. 2.2 Detailed Invoicing. Contractor/Service Provider agrees to provide City with a detailed invoice for services performed each month, within thirty (30) days of the end of the month in which the services were performed, unless otherwise specified in Exhibit A. Invoicing shall begin on the first of the month following the Effective Date of the Agreement. All charges must be presented in a line item format with each task separately explained in reasonable detail. Each invoice shall include the current monthly amount being billed, the amount invoiced to date, and the remaining amount available under any approved budget. Contractor/Service Provider must obtain prior written authorization from City for any fees or expenses that exceed the estimated budget. 2.3 Payment to Contractor/Service Provider. Upon receipt of a properly prepared invoice and confirmation that the Required Services detailed in the invoice have been satisfactorily performed, City shall pay Contractor/Service Provider for the invoice amount within thirty (30) days. Payment shall be made in accordance with the terms and conditions set forth in Exhibit A and section 2.4, below. At City’s discretion, invoices not timely submitted may be subject to a penalty of up to five percent (5%) of the amount invoiced. 2.4 [Reserved] 2.5 Reimbursement of Costs. City may reimburse Contractor/Service Provider’s out-of-pocket costs incurred by Contractor/Service Provider in the performance of the Required Services if negotiated in advance and included in Exhibit A. Unless specifically provided in Exhibit A, Contractor/Service Provider shall be responsible for any and all out-of-pocket costs incurred by Contractor/Service Provider in the performance of the Required Services. 2.6 Exclusions. City shall not be responsible for payment to Contractor/Service Provider for any fees or costs in excess of any agreed upon budget, rate or other maximum amount(s) provided for in Exhibit A. City shall also not be responsible for any cost: (a) incurred prior to the Effective Date; or (b) arising out of or Page 518 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 4 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 related to the errors, omissions, negligence or acts of willful misconduct of Contractor/Service Provider, its agents, employees, or subcontractors. 2.7 Payment Not Final Approval. Contractor/Service Provider understands and agrees that payment to the Contractor/Service Provider or reimbursement for any Contractor/Service Provider costs related to the performance of Required Services does not constitute a City final decision regarding whether such payment or cost reimbursement is allowable and eligible for payment under this Agreement, nor does it constitute a waiver of any violation by Contractor/Service Provider of the terms of this Agreement. If City determines that Contractor/Service Provider is not entitled to receive any amount of compensation already paid, City will notify Contractor/Service Provider in writing and Contractor/Service Provider shall promptly return such amount. 3. INSURANCE 3.1 Required Insurance. Contractor/Service Provider must procure and maintain, during the period of performance of Required Services under this Agreement, and for twelve months after completion of Required Services, the policies of insurance described on the attached Exhibit B, incorporated into the Agreement by this reference (the “Required Insurance”). The Required Insurance shall also comply with all other terms of this Section. 3.2 Deductibles and Self-Insured Retentions. Any deductibles or self-insured retentions relating to the Required Insurance must be disclosed to and approved by City in advance of the commencement of work. 3.3 Standards for Insurers. Required Insurance must be placed with licensed insurers admitted to transact business in the State of California with a current A.M. Best’s rating of A V or better, or, if insurance is placed with a surplus lines insurer, insurer must be listed on the State of California List of Eligible Surplus Lines Insurers (LESLI) with a current A.M. Best’s rating of no less than A X. For Workers’ Compen sation Insurance, insurance issued by the State Compensation Fund is also acceptable. 3.4 Subcontractors. Contractor/Service Provider must include all sub-Contractor/Service Providers/sub- contractors as insureds under its policies and/or furnish separate certificates and endorsements demonstrating separate coverage for those not under its policies. Any separate coverage for sub-Contractor/Service Providers must also comply with the terms of this Agreement. 3.5 Additional Insureds. City, its officers, officials, employees, agents, and volunteers must be named as additional insureds with respect to any policy of general liability, automobile, or pollution insurance specified as required in Exhibit B or as may otherwise be specified by City’s Risk Manager.. The general liability additional insured coverage must be provided in the form of an endorsement to the Contractor/Service Provider’s insurance using ISO CG 2010 (11/85) or its equivalent; such endorsement must not exclude Products/Completed Operations coverage. 3.6 General Liability Coverage to be “Primary.”Contractor/Service Provider’s general liability coverage must be primary insurance as it pertains to the City, its officers, officials, employees, agents, and volunteers. Any insurance or self-insurance maintained by the City, its officers, officials, employees, or volunteers is wholly separate from the insurance provided by Contractor/Service Provider and in no way relieves Contractor/Service Provider from its responsibility to provide insurance. 3.7 No Cancellation. No Required Insurance policy may be canceled by either Party during the required insured period under this Agreement, except after thirty days’ prior written notice to the City by certified mail, Page 519 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 5 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 return receipt requested. Prior to the effective date of any such cancellation Contractor/Service Provider must procure and put into effect equivalent coverage(s). 3.8 Waiver of Subrogation. Contractor/Service Provider’s insurer(s) will provide a Waiver of Subrogation in favor of the City for each Required Insurance policy under this Agreement. In addition, Contractor/Service Provider waives any right it may have or may obtain to subrogation for a claim against City. 3.9 Verification of Coverage. Prior to commencement of any work, Contractor/Service Provider shall furnish City with original certificates of insurance and any amendatory endorsements necessary to demonstrate to City that Contractor/Service Provider has obtained the Required Insurance in compliance with the terms of this Agreement. The words “will endeavor” and “but failure to mail such notice shall impose no obligation or liability of any kind upon the company, its agents, or representatives” or any similar language must be deleted from all certificates. The required certificates and endorsements should otherwise be on industry standard forms. The City reserves the right to require, at any time, complete, certified copies of all required insurance policies, including endorsements evidencing the coverage required by these specifications. 3.10 Claims Made Policy Requirements. If General Liability, Pollution and/or Asbestos Pollution Liability and/or Errors & Omissions coverage are required and are provided on a claims-made form, the following requirements also apply: a.The “Retro Date” must be shown, and must be before the date of this Agreement or the beginning of the work required by this Agreement. b. Insurance must be maintained, and evidence of insurance must be provided, for at least five (5) years after completion of the work required by this Agreement. c. If coverage is canceled or non-renewed, and not replaced with another claims-made policy form with a “Retro Date” prior to the effective date of this Agreement, the Contractor/Service Provider must purchase “extended reporting” coverage for a minimum of five (5) years after completion of the work required by this Agreement. d. A copy of the claims reporting requirements must be submitted to the City for review. 3.11 Not a Limitation of Other Obligations. Insurance provisions under this section shall not be construed to limit the Contractor/Service Provider’s obligations under this Agreement, including Indemnity. 3.12 Additional Coverage. To the extent that insurance coverage provided by Contractor/Service Provider maintains higher limits than the minimums appearing in Exhibit B, City requires and shall be entitled to coverage for higher limits maintained. Page 520 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 6 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 4. INDEMNIFICATION 4.1. General. To the maximum extent allowed by law, Contractor/Service Provider shall timely and fully protect, defend, reimburse, indemnify and hold harmless City, its elected and appointed officers, agents, employees and volunteers (collectively, “Indemnified Parties”), from and against any and all claims, demands, causes of action, costs, expenses, (including reasonable attorneys’ fees and court costs), liability, loss, damage or injury, in law or equity, to property or persons, including wrongful death, in any manner arising out of or incident to any alleged acts, omissions, negligence, or willful misconduct of Contractor/Service Provider, its officials, officers, employees, agents, and contractors, arising out of or in connection with the performance of the Required Services, the results of such performance, or this Agreement. This indemnity provision does not include any claims, damages, liability, costs and expenses arising from the sole negligence or willful misconduct of the Indemnified Parties. Also covered is liability arising from, connected with, caused by or claimed to be caused by the active or passive negligent acts or omissions of the Indemnified Parties which may be in combination with the active or passive negligent acts or omissions of the Contractor/Service Provider, its employees, agents or officers, or any third party. 4.2. Modified Indemnity Where Agreement Involves Design Professional Services. Notwithstanding the forgoing, if the services provided under this Agreement are design professional services, as defined by California Civil Code section 2782.8, as may be amended from time to time, the defense and indemnity obligation under Section 1, above, shall be limited to the extent required by California Civil Code section 2782.8. 4.3 Costs of Defense and Award. Included in Contractor/Service Provider’s obligations under this Section 4 is Contractor/Service Provider’s obligation to defend, at Contractor/Service Provider’s own cost, expense and risk, and with counsel approved in writing by City, any and all suits, actions or other legal proceedings that may be brought or instituted against one or more of the Indemnified Parties. Subject to the limitations in this Section 4, Contractor/Service Provider shall pay and satisfy any judgment, award or decree that may be rendered against one or more of the Indemnified Parties for any and all related legal expenses and costs incurred by any of them. 4.4. Contractor/Service Provider’s Obligations Not Limited or Modified. Contractor/Service Provider’s obligations under this Section 4 shall not be limited to insurance proceeds, if any, received by the Indemnified Parties, or by any prior or subsequent declaration by the Contractor/Service Provider. Furthermore, Contractor/Service Provider’s obligations under this Section 4 shall in no way limit, modify or excuse any of Contractor/Service Provider’s other obligations or duties under this Agreement. 4.5. Enforcement Costs. Contractor/Service Provider agrees to pay any and all costs and fees City incurs in enforcing Contractor/Service Provider’s obligations under this Section 4. 4.6 Survival. Contractor/Service Provider’s obligations under this Section 4 shall survive the termination of this Agreement. 5.FINANCIAL INTERESTS OF CONTRACTOR/SERVICE PROVIDER. 5.1 Form 700 Filing. The California Political Reform Act and the Chula Vista Conflict of Interest Code require certain government officials and Contractor/Service Providers performing work for government agencies to publicly disclose certain of their personal assets and income using a Statement of Economic Interests form (Form 700). In order to assure compliance with these requirements, Contractor/Service Page 521 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 7 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 Provider shall comply with the disclosure requirements identified in the attached Exhibit C, incorporated into the Agreement by this reference. 5.2 Disclosures; Prohibited Interests. Independent of whether Contractor/Service Provider is required to file a Form 700, Contractor/Service Provider warrants and represents that it has disclosed to City any economic interests held by Contractor/Service Provider, or its employees or subcontractors who will be performing the Required Services, in any real property or project which is the subject of this Agreement. Contractor/Service Provider warrants and represents that it has not employed or retained any company or person, other than a bona fide employee or approved subcontractor working solely for Contractor/Service Provider, to solicit or secure this Agreement. Further, Contractor/Service Provider warrants and represents that it has not paid or agreed to pay any company or person, other than a bona fide employee or approved subcontractor working solely for Contractor/Service Provider, any fee, commission, percentage, brokerage fee, gift or other consideration contingent upon or resulting from the award or making of this Agreement. Contractor/Service Provider further warrants and represents that no officer or employee of City, has any interest, whether contractual, non-contractual, financial or otherwise, in this transaction, the proceeds hereof, or in the business of Contractor/Service Provider or Contractor/Service Provider’s subcontractors. Contractor/Service Provider further agrees to notify City in the event any such interest is discovered whether or not such interest is prohibited by law or this Agreement. For breach or violation of any of these warranties, City shall have the right to rescind this Agreement without liability. 6. REMEDIES 6.1 Termination for Cause. If for any reason whatsoever Contractor/Service Provider shall fail to perform the Required Services under this Agreement, in a proper or timely manner, or if Contractor/Service Provider shall violate any of the other covenants, agreements or conditions of this Agreement (each a “Default”), in addition to any and all other rights and remedies City may have under this Agreement, at law or in equity, City shall have the right to terminate this Agreement by giving five (5) days written notice to Contractor/Service Provider. Such notice shall identify the Default and the Agreement termination date. If Contractor/Service Provider notifies City of its intent to cure such Default prior to City’s specified termination date, and City agrees that the specified Default is capable of being cured, City may grant Contractor/Service Provider up to ten (10) additional days after the designated termination date to effectuate such cure. In the event of a termination under this Section 6.1, Contractor/Service Provider shall immediately provide City any and all ”Work Product” (defined in Section 7 below) prepared by Contractor/Service Provider as part of the Required Services. Such Work Product shall be Cit y’s sole and exclusive property as provided in Section 7 hereof. Contractor/Service Provider may be entitled to compensation for work satisfactorily performed prior to Contractor/Service Provider’s receipt of the Default notice; provided, however, in no event shall such compensation exceed the amount that would have been payable under this Agreement for such work, and any such compensation shall be reduced by any costs incurred or projected to be incurred by City as a result of the Default. 6.2 Termination or Suspension for Convenience of City. City may suspend or terminate this Agreement, or any portion of the Required Services, at any time and for any reason, with or without cause, by giving specific written notice to Contractor/Service Provider of such termination or suspension at least fifteen (15) days prior to the effective date thereof. Upon receipt of such notice, Contractor/Service Provider shall immediately cease all work under the Agreement and promptly deliver all “Work Product” (defined in Section 7 below) to City. Such Work Product shall be City's sole and exclusive property as provided in Section 7 hereof. Contractor/Service Provider shall be entitled to receive just and equitable compensation for this Work Product in an amount equal to the amount due and payable under this Agreement for work satisfactorily Page 522 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 8 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 performed as of the date of the termination/suspension notice plus any additional remaining Required Services requested or approved by City in advance that would maximize City’s value under the Agreement. 6.3 Waiver of Claims. In the event City terminates the Agreement in accordance with the terms of this Section, Contractor/Service Provider hereby expressly waives any and all claims for damages or compensation as a result of such termination except as expressly provided in this Section 6. 6.4 Administrative Claims Requirements and Procedures. No suit or arbitration shall be brought arising out of this Agreement against City unless a claim has first been presented in writing and filed with City and acted upon by City in accordance with the procedures set forth in Chapter 1.34 of the Chula Vista Municipal Code, as same may be amended, the provisions of which, including such policies and procedures used by City in the implementation of same, are incorporated herein by this reference. Upon request by City, Contractor/Service Provider shall meet and confer in good faith with City for the purpose of resolving any dispute over the terms of this Agreement. 6.5 Governing Law/Venue. This Agreement shall be governed by and construed in accordance with the laws of the State of California. Any action arising under or relating to this Agreement shall be brought only in San Diego County, State of California. Contractor/Service Provider hereby waives any right to remove any action from San Diego County as may otherwise be permitted by California Code of Civil Procedure section 394. 6.6 Service of Process. Contractor/Service Provider agrees that it is subject to personal jurisdiction in California. If Contractor/Service Provider is a foreign corporation, limited liability company, or partnership that is not registered with the California Secretary of State, Contractor/Service Provider irrevocably consents to service of process on Contractor/Service Provider by first class mail directed to the individual and address listed under “For Legal Notice,” in section 1.B. of Exhibit A to this Agreement, and that such service shall be effective five days after mailing. 7. OWNERSHIP AND USE OF WORK PRODUCT All reports, studies, information, data, statistics, forms, designs, plans, procedures, systems and any other materials or properties produced in whole or in part under this Agreement in connection with the performance of the Required Services (collectively “Work Product”) shall be the sole and exclusive property of City. No such Work Product shall be subject to private use, copyrights or patent rights by Contractor/Service Provider in the United States or in any other country without the express, prior written consent of City. City shall have unrestricted authority to publish, disclose, distribute, and otherwise use, copyright or patent, in whole or in part, any such Work Product, without requiring any permission of Contractor/Service Provider, except as may be limited by the provisions of the Public Records Act or expressly prohibited by other applicable laws. With respect to computer files containing data generated as Work Product, Contractor/Service Provider shall make available to City, upon reasonable written request by City, the necessary functional computer software and hardware for purposes of accessing, compiling, transferring and printing computer files. 8. GENERAL PROVISIONS 8.1 Amendment. This Agreement may be amended, but only in writing signed by both Parties. 8.2 Assignment. City would not have entered into this Agreement but for Contractor/Service Provider’s unique qualifications and traits. Contractor/Service Provider shall not assign any of its rights or Page 523 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 9 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 responsibilities under this Agreement, nor any part hereof, without City’s prior written consent, which City may grant, condition or deny in its sole discretion. 8.3 Authority. The person(s) executing this Agreement for Contractor/Service Provider warrants and represents that they have the authority to execute same on behalf of Contractor/Service Provider and to bind Contractor/Service Provider to its obligations hereunder without any further action or direction from Contractor/Service Provider or any board, principle or officer thereof. 8.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed an original, but all of which shall constitute one Agreement after each Party has signed such a counterpart. 8.5 Entire Agreement. This Agreement together with all exhibits attached hereto and other agreements expressly referred to herein, constitutes the entire Agreement between the Parties with respect to the subject matter contained herein. All exhibits referenced herein shall be attached hereto and are incorporated herein by reference. All prior or contemporaneous agreements, understandings, representations, warranties and statements, oral or written, are superseded. 8.6 Record Retention. During the course of the Agreement and for three (3) years following completion of the Required Services, Contractor/Service Provider agrees to maintain, intact and readily accessible, all data, documents, reports, records, contracts, and supporting materials relating to the performance of the Agreement, including accounting for costs and expenses charged to City, including such records in the possession of sub-contractors/sub-Contractor/Service Providers. 8.7 Further Assurances. The Parties agree to perform such further acts and to execute and deliver such additional documents and instruments as may be reasonably required in order to carry out the provisions of this Agreement and the intentions of the Parties. 8.8 Independent Contractor. Contractor/Service Provider is and shall at all times remain as to City a wholly independent contractor. Neither City nor any of its officers, employees, agents or volunteers shall have control over the conduct of Contractor/Service Provider or any of Contractor/Service Provider’s officers, employees, or agents (“Contractor/Service Provider Related Individuals”), except as set forth in this Agreement. No Contractor/Service Provider Related Individuals shall be deemed employees of City, and none of them shall be entitled to any benefits to which City employees are entitled, including but not limited to, overtime, retirement benefits, worker's compensation benefits, injury leave or other leave benefits. Furthermore, City will not withhold state or federal income tax, social security tax or any other payroll tax with respect to any Contractor/Service Provider Related Individuals; instead, Contractor/Service Provider shall be solely responsible for the payment of same and shall hold the City harmless with respect to same. Contractor/Service Provider shall not at any time or in any manner represent that it or any of its Contractor/Service ProviderRelated Individuals are employees or agents of City. Contractor/Service Provider shall not incur or have the power to incur any debt, obligation or liability whatsoever against City, or bind City in any manner. 8.9 Notices. All notices, demands or requests provided for or permitted to be given pursuant to this Agreement must be in writing. All notices, demands and requests to be sent to any Party shall be deemed to have been properly given or served if personally served or deposited in the United States mail, addressed to such Party, postage prepaid, registered or certified, with return receipt requested, at the addresses identified in this Agreement at the places of business for each of the designated Parties as indicated in Exhibit A, or otherwise provided in writing. Page 524 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 10 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 8.10 Electronic Signatures. Each Party agrees that the electronic signatures, whether digital or encrypted, of the Parties included in this Agreement are intended to authenticate this writing and to have the same force and effect as manual signatures. Electronic Signature means any electronic sound, symbol, or process attached to or logically associated with a record and executed and adopted by a Party with the intent to sign such record, including facsimile or email electronic signatures, pursuant to the California Uniform Electronic Transactions Act (Cal. Civ. Code §§ 1633.1 to 1633.17) as amended from time to time. (End of page. Next page is signature page.) Page 525 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 11 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 SIGNATURE PAGE CONTRACTOR/SERVICE PROVIDER SERVICES AGREEMENT IN WITNESS WHEREOF, by executing this Agreement where indicated below, City and Contractor/Service Provider agree that they have read and understood all terms and conditions of the Agreement, that they fully agree and consent to bound by same, and that they are freely entering into this Agreement as of the Effective Date. PSC INVESTIGATIONS LLC CITY OF CHULA VISTA BY:________________________________BY: ________________________________ MICHAEL LUIS HERNANDEZ JOHN MCCANN MANAGER/OWNER MAYOR ATTEST BY: ________________________________ Kerry K. Bigelow, MMC City Clerk APPROVED AS TO FORM BY: _______________________________ Jill D.S. Maland Lounsbery Ferguson Altona & Peak Acting City Attorney Page 526 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 12 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 EXHIBIT A SCOPE OF WORK AND PAYMENT TERMS 1. Contact People for Contract Administration and Legal Notice A. City Contract Administration: Chula Vista Police Department Jonathan Alegre, Police Administrative Services Administrator 315 Fourth Ave Chula Vista CA, 91910 (619) 476-2570 jalegre@chulavistapd.org For Legal Notice Copy to: City of Chula Vista City Attorney 276 Fourth Avenue, Chula Vista, CA 91910 619-691-5037 CityAttorney@chulavistaca.gov B. Contractor/Service Provider Contract Administration: PSC INVESTIGATIONS LLC Michael Luis Hernandez, Owner 410 Rock Ridge Place, Escondido, CA 92027 (760) 509-5061 pscinvestigationsllc@gmail.com For Legal Notice Copy to: [same as above] 2. Required Services A. General Description: PSC Investigations LLC will provide Background Investigative Services to the Police Department. B. Detailed Description: PSC Investigations LLC will provide Background Investigative Services to the Police Department, as outlined below. 1. Background Investigators (BGIs) must be licensed Private Investigators in the State of California 2. BGIs must have completed a California Peace Officers Standards and Training (POST) certified background investigators school 3. Background investigation and related reports must follow the POST format when applicable 4. BGIs should have prior law enforcement experience (preferred) 5. BGIs must have access and ability to submit background investigative reports and updates via CVPD contracted eSOPH background investigations software program Page 527 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 13 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 6. Background investigations will be completed within 30-days, unless otherwise preapproved by the CVPD Professional Standards Unit (PSU) 7. Ability to complete and submit 50-100 background investigative packets annually 8. BGIs must be available to travel to conduct out of county/state/country investigations 9. BGIs will assess applicant and agency submitted materials 10. BGIs will ensure reference questionnaires are sent when applicable 11. BGIs will conduct applicant home visits 12. BGIs will conduct neighborhood/neighbor checks for current and past residences 13. BGIs will conduct employer visits/personnel file reviews for current and past employment 14. BGIs will send out criminal history checks to law enforcement (LE) agencies within residential jurisdictions 15. BGIs will review and compile reference questionnaires 16. BGIs will interview selected references, often in person when necessary 17. BGIs will confirm and review other LE agency candidate applications and review disposition 18. BGIs will complete investigative narratives using POST format or Agency preferred format 19. Investigative packages reviewed by investigating company management 20. BGIs will submit investigative packages to PSU 21. Expedited background investigation –Ability to complete a background investigation within two (2) weeks. 3. Term:In accordance with Section 1.10 of this Agreement, the term of this Agreement shall begin May 16, 2023 and end on May 15, 2025 for completion of all Required Services. 4. Compensation: A. Form of Compensation ܈ Time and Materials. For performance of the Required Services by Contractor/Service Provider as identified in Section 2.B., above, City shall pay Contractor/Service Provider a flat rate of $1,250.00 per investigative report. In the event an investigation is prematurely terminated due to City-directed disqualification (DQ), non-select, or any other reason, City shall pay Contractor/Service Provider $50.00 per hour (not to exceed $1,250.00) for terminated investigations. B. Reimbursement of Costs ܈ Invoiced or agreed-upon amounts as follows: Out of county travel expenses will be mutually agreed upon on a case-by-case basis. Notwithstanding the foregoing, the maximum amount to be paid to the Contractor/Service Provider for services performed through May 15, 2025 shall not exceed $400,000. 5. Special Provisions: ܆ Permitted Sub-Contractor/Service Providers: None. ܆ Security for Performance: None. ܈ Notwithstanding the completion date set forth in Section 3 above, City has option to extend this Agreement for three (3) additional terms, each limited to a one-year increment which shall begin every May 16 and end May 15 of the next succeeding year, but no additional term shall extend this Agreement to any later than May 15, Page 528 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 14 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 2028. The City Manager or Director of Finance/Treasurer shall be authorized to exercise the extensions on behalf of the City. If the City exercises an option to extend, each extension shall be on the same terms and conditions contained herein, provided that the amounts specified in Section 4 above may be increased by up to a negotiable amount for each extension. The City shall give written notice to Contractor/Service Provider of the City’s election to exercise the extension via the Notice of Exercise of Option to Extend document. Such notice shall be provided at least 30 days prior to the expiration of the term. Page 529 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 15 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 EXHIBIT B INSURANCE REQUIREMENTS Contractor/Service Provider shall adhere to all terms and conditions of Section 3 of the Agreement and agrees to provide the following types and minimum amounts of insurance, as indicated by checking the applicable boxes (x). Type of Insurance Minimum Amount Form ܈ General Liability: Including products and completed operations, personal and advertising injury $2,000,000 per occurrence for bodily injury, personal injury (including death), and property damage. If Commercial General Liability insurance with a general aggregate limit is used, either the general aggregate limit must apply separately to this Agreement or the general aggregate limit must be twice the required occurrence limit Additional Insured Endorsement or Blanket AI Endorsement for City* Waiver of Recovery Endorsement Insurance Services Office Form CG 00 01 *Must be primary and must not exclude Products/Completed Operations ܈ Automobile Liability $1,000,000 per accident for bodily injury, including death, and property damage Insurance Services Office Form CA 00 01 Code 1-Any Auto Code 8-Hired Code 9-Non Owned ܈ Workers’ Compensation Employer’s Liability $1,000,000 each accident $1,000,000 disease policy limit $1,000,000 disease each employee Waiver of Recovery Endorsement Other Negotiated Insurance Terms: NONE. Page 530 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda 16 City of Chula Vista Agreement No.: 2023-068 Service Provider Name: PSC Investigations LLC Rev. 2/24/2023 EXHIBIT C CONTRACTOR/SERVICE PROVIDER CONFLICT OF INTEREST DESIGNATION The Political Reform Act1 and the Chula Vista Conflict of Interest Code2 (“Code”) require designated state and local government officials, including some Contractor/Service Providers, to make certain public disclosures using a Statement of Economic Interests form (Form 700). Once filed, a Form 700 is a public document, accessible to any member of the public. In addition, Contractor/Service Providers designated to file the Form 700 are also required to comply with certain ethics training requirements.3 ܆ A. Contractor/Service Provider IS a corporation or limited liability company and is therefore EXCLUDED4 from disclosure. ܈ B. Contractor/Service Provider is NOT a corporation or limited liability company and disclosure designation is as follows: APPLICABLE DESIGNATIONS FOR INDIVIDUAL(S) ASSIGNED TO PROVIDE SERVICES (Category descriptions available at www.chulavistaca.gov/departments/city-clerk/conflict-of-interest-code.) Name Email Address Applicable Designation ܆ A. Full Disclosure ܆ B. Limited Disclosure (select one or more of the categories under which the Contractor shall file): ܆ 1. ܆ 2. ܆ 3. ܆ 4. ܆ 5. ܆ 6. ܆ 7. Justification: ܈ C. Excluded from Disclosure 1.Required Filers Each individual who will be performing services for the City pursuant to the Agreement and who meets the definition of “Contractor/Service Provider,” pursuant to FPPC Regulation 18700.3, must file a Form 700. 2.Required Filing Deadlines Each initial Form 700 required under this Agreement shall be filed with the Office of the City Clerk via the City's online filing system, NetFile, within 30 days of the approval of the Agreement. Additional Form 700 filings will be required annually on April 1 during the term of the Agreement, and within 30 days of the termination of the Agreement. 3. Filing Designation The City Department Director will designate each individual who will be providing services to the City pursuant to the Agreement as full disclosure, limited disclosure, or excluded from disclosure, based on an analysis of the services the Contractor/Service Provider will provide. Notwithstanding this designation or anything in the Agreement, the Contractor/Service Provider is ultimately responsible for complying with FPPC regulations and filing requirements. If you have any questions regarding filing requirements, please do not hesitate to contact the City Clerk at (619)691-5041, or the FPPC at 1-866-ASK-FPPC, or (866) 275-3772 *2. Pursuant to the duly adopted City of Chula Vista Conflict of Interest Code, this document shall serve as the written determination of the Contractor’s requirement to comply with the disclosure requirements set forth in the Code. Completed by: Jonathan Alegre, Police Department 1 Cal. Gov. Code §§81000 et seq.; FPPC Regs. 18700.3 and 18704. 2 Chula Vista Municipal Code §§2.02.010-2.02.040. 3 Cal. Gov. Code §§53234, et seq. 4 CA FPPC Adv. A-15-147 (Chadwick) (2015); Davis v. Fresno Unified School District (2015) 237 Cal.App.4th 261; FPPC Reg. 18700.3 (Consultant defined as an “individual” who participates in making a governmental decision; “individual” does not include corporation or limited liability company). Page 531 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda v.003 Page | 1 May 16, 2023 ITEM TITLE Contracted Janitorial Services: Approve the First Amendment with Nova Commercial to Increase the Maximum Contract Amount and Add Additional Facilities Report Number: 23-0102 Location: City Facilities – including Police, Libraries, and Recreation Centers Department: Public Works Environmental Notice: The activity is not a “Project” as defined under Section 15378 of the California Environmental Quality Act State Guidelines; therefore, pursuant to State Guidelines Section 15060(c)(3) no environmental review is required. Recommended Action Adopt a resolution approving the first amendment to the agreement with Nova Commercial for janitorial services to increase the maximum not-to-exceed contract amount from $2,250,000 to $3,500,000 over the 5- year term of the agreement and add additional City facilities. SUMMARY In July 2022 the City entered into an agreement with Nova Commercial to provide janitorial services at various City facilities. Staff now recommends that Council approve the first amendment to the agreement that will extend the first year of the term to include fiscal year 2024, increase the maximum not-to-exceed contract amount from $2,250,000 to $3,500,000 over the 5-year term of the agreement and add additional City facilities. ENVIRONMENTAL REVIEW The Director of Development Services has reviewed the proposed activity for compliance with the California Environmental Quality Act (CEQA) and has determined that the activity is not a “Project” as defined under Section 15378 of the State CEQA Guidelines because the proposed activity consists of a governmental fiscal/administrative activity which does not result in a physical change in the environment; therefore, Page 532 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 2 pursuant to Section 15060(c)(3) of the State CEQA Guidelines, the activity is not subject to CEQA. Thus, no environmental review is required. BOARD/COMMISSION/COMMITTEE RECOMMENDATION Not applicable. DISCUSSION On March 4, 2022, the City of Chula Vista issued a Request for Proposals (RFP), seeking a contractor to provide janitorial services at various City facilities. The RFP closed on March 25, 2022 and six proposals were received. An evaluation committee evaluated, scored, and ranked the responses based on the following criteria: experience, personnel, operations/qualifications, and cost. Nova Commercial ranked as the top vendor. The City entered into an agreement with Nova Commercial in July 2022. Key provisions of the original contract include, but are not limited to, the following: Services – the contractor will provide janitorial services at designated City facilities. These services generally include cleaning, disinfecting, and/or sanitizing exterior and entry areas, offices, conference rooms, corridors, stairs, elevators, restrooms, lunchrooms and break rooms. Facilities – The original contract included the following City facilities: Police Department, Libraries (Civic Center, South, and Otay Ranch), and Heritage Recreation Center and Veterans Recreation Center. Additional facilities could be included as funding permits upon mutual agreement with the vendor. Term - The contract term was initially from July 1, 2022 to June 30, 2023. If Nova Commercial’s work performance is satisfactory, the parties may mutually agree in writing to extend the contract for four (4) additional one (1) year periods. The annual option year renewals would be effective from July 1 to June 30 - the City’s Fiscal Year. If the vendor’s work performance is not satisfactory, the City reserves the right to not renew the contract without penalty. If the parties agree to extend the contract for the option years, acceptable price increases may be agreed to and such increases would be based on changes in the annual San Diego Area Consumer Price Index for Urban Wage Earners and Clerical Workers (CPI-W), in an amount not to exceed 5%. Nova Commercial’s work performance has been satisfactory; staff is proposing an amendment to the contract to add the following: x Extend the initial term to include fiscal year 2024 with three additional optional one-year extensions, this change does not extend the overall end date if all extensions are executed x Add janitorial services as follows: o Loma Recreation and Aquatic Center – the initial quote is only for the Recreation Center and will be amended to add the Aquatic Center when the facility is open to the public o Norman Park Senior Center o Saturday services at various Recreation Centers x Increase the total value of the contract to $3.5 million for the whole five years – including all extensions Page 533 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page | 3 Contracted janitorial services allows the City to provide expanded coverage across various City facilities. The fiscal year 2023 Adopted Budget included the elimination of 3.0 vacant Custodian positions and the addition of an equivalent amount to Supplies and Services to fund the contract. The proposed fiscal year 2024 budget will include the elimination of 3.0 vacant Custodial positions and the addition of an equivalent budget increase in Supplies and Services to fund the increase in the contract amount due to the addition of facilities to the contract. Eliminated positions were/are all vacant positions – no current custodial staff will be adversely impacted by this change. Adding contracted janitorial services gives the City greater flexibility in addressing janitorial needs across various City facilities. The long-term service delivery model would be to have a hybrid of City Custodians and contracted janitorial services to meet City needs in a cost-effective way that still meets City standards. Additional City facilities may be added to the contract as vacancies occur and funding is available. DECISION-MAKER CONFLICT Staff has determined that the action contemplated by this item solely concerns the repairs, replacement, or maintenance of existing streets, water, sewer, storm drainage or similar facilities, and any member’s property will not be affected disproportionately to other properties receiving the same services. Consequently, pursuant to California Code of Regulations Title 2, sections 18700 and 18702.2(d)(1)), this item does not present a real property-related conflict of interest under the Political Reform Act (Cal. Gov't Code § 87100, et seq.). Staff is not independently aware, and has not been informed by any City Council member, of any other fact that may constitute a basis for a decision-maker conflict of interest in this matter. CURRENT-YEAR FISCAL IMPACT There are sufficient savings in the Public Works-Custodial budget to offset the cost of adding the additional facilities in the current fiscal year. There is no net fiscal impact to the General Fund as a result of approving the proposed contract amendment. ONGOING FISCAL IMPACT The proposed term of the contract is for a total term of five years if all extensions are executed. If the parties agree to extend the contract for the option years, cost increases would be based on changes in the annual San Diego Area Consumer Price Index for Urban Wage Earners and Clerical Workers (CPI-W), in an amount not to exceed 5%. The fiscal year proposed 2024 budget includes the elimination of three vacant Custodial positions with a corresponding reallocation to the Public Works Department Supplies and Services expense category budget. ATTACHMENTS 1. Original Agreement between City of Chula Vista and Nova Commercial to Provide Janitorial Services 2. Proposed First Amendment to Nova Commercial Janitorial Services Agreement Staff Contact: Angelica Aguilar, Assistant Director of Public Works Page 534 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. __________ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA APPROVING THE FIRST AMENDMENT TO THE AGREEMENT BETWEEN THE CITY AND NOVA COMMERCIAL FOR JANITORIAL SERVICES FOR MUTIPLE FACILITIES WHEREAS, the City previously solicited proposals for janitorial services and an evaluation committee evaluated, scored, and ranked the responses based on the following criteria: experience, personnel, operations/qualifications and costs; the committee ranked Nova Commercial first; and WHEREAS, the City entered into an agreement with Nova Commercial in July 2022 - with an initial contract term of July 1, 2022 to June 30, 2023, and upon satisfactory work performance, the parties could mutually agree to extend the contract for up to four (4) additional one (1) year periods from July 1 to June 30; and WHEREAS, Nova Commercial has performed satisfactorily, and staff is now proposing various amendments to the original agreement; and WHEREAS, the proposed amendment to the original agreement will add fiscal year 2024 to the initial term of the contract and reduce the options to extend from four (4) additional one (1) year periods to three (3) additional one (1) year periods – if all extensions are executed the total term of the contract remains five total years; and WHEREAS, the proposed amendments to the original agreement also incorporates the addition of Saturday services at various Recreation facilities and the addition of Loma Verde Recreation Center and Norman Park Senior Center; and WHEREAS, the proposed amendment to the original agreement increases the maximum not to exceed amount from $2,250,000 to $3,500,000 to account for the addition of the facilities noted above and additional facilities in the future as needed; and WHEREAS, there is sufficient funding for the contract in the Fiscal Year 2022-2023 Amended Budget; and WHEREAS, staff recommends that the City Council approve the first amendment to the Agreement with Nova Commercial for janitorial services. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Chula Vista that it approves the First Amendment to the Agreement between the City of Chula Vista and Nova Commercial for Janitorial Services for Multiple Facilities, in the form presented, with such minor modifications as may be required or approved by the City Attorney, directs the City Manager or Page 535 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda designee to execute the same, and directs that an executed copy be kept on file with the Office of the City Clerk. Presented by Approved as to form By: Matt Little Jill D.S. Maland Director of Public Works Lounsbery Ferguson Altona & Peak Acting City Attorney Page 536 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 CITY OF CHULA VISTA CONTRACTOR/SERVICE PROVIDER SERVICES AGREEMENT WITH NOVA COMMERCIAL TO PROVIDE JANITORIAL SERVICES FOR MULTIPLE FACILITES This Agreement is entered into effective as of July 1, 2022 (“Effective Date”)by and between the City of Chula Vista, a chartered municipal corporation (“City”) and NOVA COMMERCIAL, A California Corporation (“Contractor/Service Provider”) (collectively, the “Parties” and, individually, a “Party”) with reference to the following facts: RECITALS WHEREAS, City requires Janitorial services in order to maintain public buildings; and WHEREAS, In order to procure these services City solicited proposals in accordance with Chula Vista Municipal Code Section 2.56.080 for contracts exceeding $100,000; received six (6) proposals, and selected NOVA COMMERCIAL based on the rating criteria; and WHEREAS, after completing review of the proposals, staff ranked NOVA COMMERCIAL as first based on the criteria described in the solicitation; and WHEREAS, Contractor/Service Provider warrants and represents that it is experienced and staffed in a manner such that it can deliver the services required of Contractor/Service Provider to City in accordance with the time frames and the terms and conditions of this Agreement. [End of Recitals. Next Page Starts Obligatory Provisions.] Page 537 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 OBLIGATORY PROVISIONS NOW, THEREFORE, in consideration of the above recitals, the covenants contained herein, and other good and valuable consideration, the receipt and sufficiency of which the Parties hereby acknowledge, City and Contractor/Service Provider hereby agree as follows: 1. SERVICES 1.1 Required Services. Contractor/Service Provider agrees to perform the services, and deliver to City the “Deliverables” (if any) described in the attached Exhibit A, incorporated into the Agreement by this reference, within the time frames set forth therein, time being of the essence for this Agreement. The services and/or Deliverables described in Exhibit A shall be referred to herein as the “Required Services.” 1.2 Reductions in Scope of Work. City may independently, or upon request from Contractor/Service Provider, from time to time, reduce the Required Services to be performed by the Contractor/Service Provider under this Agreement. Upon doing so, City and Contractor/Service Provider agree to meet and confer in good faith for the purpose of negotiating a corresponding reduction in the compensation associated with the reduction. 1.3 Additional Services. Subject to compliance with the City’s Charter, codes, policies, procedures and ordinances governing procurement and purchasing authority, City may request Contractor/Service Provider provide additional services related to the Required Services (“Additional Services”). If so, City and Contractor/Service Provider agree to meet and confer in good faith for the purpose of negotiating an amendment to Exhibit A, to add the Additional Services. Unless otherwise agreed, compensation for the Additional Services shall be charged and paid consistent with the rates and terms already provided therein. Once added to Exhibit A, “Additional Services” shall also become “Required Services” for purposes of this Agreement. 1.4 Standard of Care. Contractor/Service Provider expressly warrants and agrees that any and all Required Services hereunder shall be performed in accordance with the highest standard of care exercised by members of the profession currently practicing under similar conditions and in similar locations. 1.5 No Waiver of Standard of Care. Where approval by City is required, it is understood to be conceptual approval only and does not relieve the Contractor/Service Provider of responsibility for complying with all laws, codes, industry standards, and liability for damages caused by negligent acts, errors, omissions, noncompliance with industry standards, or the willful misconduct of the Contractor/Service Provider or its subcontractors. 1.6 Security for Performance. In the event that Exhibit A Section 4 indicates the need for Contractor/Service Provider to provide additional security for performance of its duties under this Agreement, Contractor/Service Provider shall provide such additional security prior to commencement of its Required Services in the form and on the terms prescribed on Exhibit A, or as otherwise prescribed by the City Attorney. 1.7 Compliance with Laws. In its performance of the Required Services, Contractor/Service Provider shall comply with any and all applicable federal, state and local laws, including the Chula Vista Municipal Code. 1.8 Business License. Prior to commencement of work, Contractor/Service Provider shall obtain a business license from City. Page 538 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൣ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 1.9 Subcontractors. Prior to commencement of any work, Contractor/Service Provider shall submit for City’s information and approval a list of any and all subcontractors to be used by Contractor/Service Provider in the performance of the Required Services. Contractor/Service Provider agrees to take appropriate measures necessary to ensure that all subcontractors and personnel utilized by the Contractor/Service Provider to complete its obligations under this Agreement comply with all applicable laws, regulations, ordinances, and policies, whether federal, state, or local. In addition, if any subcontractor is expected to fulfill any responsibilities of the Contractor/Service Provider under this Agreement, Contractor/Service Provider shall ensure that each and every subcontractor carries out the Contractor/Service Provider’s responsibilities as set forth in this Agreement. 1.10 Term. This Agreement shall commence on the earlier to occur of the Effective Date or Contractor/Service Provider’s commencement of the Required Services hereunder, and shall terminate when the Parties have complied with all their obligations hereunder; provided, however, provisions which expressly survive termination shall remain in effect. 2. COMPENSATION 2.1 General. For satisfactory performance of the Required Services, City agrees to compensate Contractor/Service Provider in the amount(s) and on the terms set forth in Exhibit A, Section 4. Standard terms for billing and payment are set forth in this Section 2. 2.2 Detailed Invoicing. Contractor/Service Provider agrees to provide City with a detailed invoice for services performed each month, within thirty (30) days of the end of the month in which the services were performed, unless otherwise specified in Exhibit A. Invoicing shall begin on the first of the month following the Effective Date of the Agreement. All charges must be presented in a line item format with each task separately explained in reasonable detail. Each invoice shall include the current monthly amount being billed, the amount invoiced to date, and the remaining amount available under any approved budget. Contractor/Service Provider must obtain prior written authorization from City for any fees or expenses that exceed the estimated budget. 2.3 Payment to Contractor/Service Provider. Upon receipt of a properly prepared invoice and confirmation that the Required Services detailed in the invoice have been satisfactorily performed, City shall pay Contractor/Service Provider for the invoice amount within thirty (30) days. Payment shall be made in accordance with the terms and conditions set forth in Exhibit A and section 2.4, below. At City’s discretion, invoices not timely submitted may be subject to a penalty of up to five percent (5%) of the amount invoiced. 2.4 Retention Policy. City shall retain ten percent (10%) of the amount due for Required Services detailed on each invoice (the “holdback amount”). Upon City review and determination of Project Completion, the holdback amount will be issued to Contractor/Service Provider. 2.5 Reimbursement of Costs. City may reimburse Contractor/Service Provider’s out-of-pocket costs incurred by Contractor/Service Provider in the performance of the Required Services if negotiated in advance and included in Exhibit A. Unless specifically provided in Exhibit A, Contractor/Service Provider shall be responsible for any and all out-of-pocket costs incurred by Contractor/Service Provider in the performance of the Required Services. 2.6 Exclusions. City shall not be responsible for payment to Contractor/Service Provider for any fees or costs in excess of any agreed upon budget, rate or other maximum amount(s) provided for in Exhibit A. City Page 539 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൤ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 shall also not be responsible for any cost: (a) incurred prior to the Effective Date; or (b) arising out of or related to the errors, omissions, negligence or acts of willful misconduct of Contractor/Service Provider, its agents, employees, or subcontractors. 2.7 Payment Not Final Approval. Contractor/Service Provider understands and agrees that payment to the Contractor/Service Provider or reimbursement for any Contractor/Service Provider costs related to the performance of Required Services does not constitute a City final decision regarding whether such payment or cost reimbursement is allowable and eligible for payment under this Agreement, nor does it constitute a waiver of any violation by Contractor/Service Provider of the terms of this Agreement. If City determines that Contractor/Service Provider is not entitled to receive any amount of compensation already paid, City will notify Contractor/Service Provider in writing and Contractor/Service Provider shall promptly return such amount. 3. INSURANCE 3.1 Required Insurance. Contractor/Service Provider must procure and maintain, during the period of performance of Required Services under this Agreement, and for twelve months after completion of Required Services, the policies of insurance described on the attached Exhibit B, incorporated into the Agreement by this reference (the “Required Insurance”). The Required Insurance shall also comply with all other terms of this Section. 3.2 Deductibles and Self-Insured Retentions. Any deductibles or self-insured retentions relating to the Required Insurance must be disclosed to and approved by City in advance of the commencement of work. 3.3 Standards for Insurers. Required Insurance must be placed with licensed insurers admitted to transact business in the State of California with a current A.M. Best’s rating of A V or better, or, if insurance is placed with a surplus lines insurer, insurer must be listed on the State of California List of Eligible Surplus Lines Insurers (LESLI) with a current A.M. Best’s rating of no less than A X. For Workers’ Compensation Insurance, insurance issued by the State Compensation Fund is also acceptable. 3.4 Subcontractors. Contractor/Service Provider must include all sub-Contractor/Service Providers/sub- contractors as insureds under its policies and/or furnish separate certificates and endorsements demonstrating separate coverage for those not under its policies. Any separate coverage for sub-Contractor/Service Providers must also comply with the terms of this Agreement. 3.5 Additional Insureds. City, its officers, officials, employees, agents, and volunteers must be named as additional insureds with respect to any policy of general liability, automobile, or pollution insurance specified as required in Exhibit B or as may otherwise be specified by City’s Risk Manager.. The general liability additional insured coverage must be provided in the form of an endorsement to the Contractor/Service Provider’s insurance using ISO CG 2010 (11/85) or its equivalent; such endorsement must not exclude Products/Completed Operations coverage. 3.6 General Liability Coverage to be “Primary.”Contractor/Service Provider’s general liability coverage must be primary insurance as it pertains to the City, its officers, officials, employees, agents, and volunteers. Any insurance or self-insurance maintained by the City, its officers, officials, employees, or volunteers is wholly separate from the insurance provided by Contractor/Service Provider and in no way relieves Contractor/Service Provider from its responsibility to provide insurance. Page 540 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൥ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 3.7 No Cancellation. No Required Insurance policy may be canceled by either Party during the required insured period under this Agreement, except after thirty days’ prior written notice to the City by certified mail, return receipt requested. Prior to the effective date of any such cancellation Contractor/Service Provider must procure and put into effect equivalent coverage(s). 3.8 Waiver of Subrogation. Contractor/Service Provider’s insurer(s) will provide a Waiver of Subrogation in favor of the City for each Required Insurance policy under this Agreement. In addition, Contractor/Service Provider waives any right it may have or may obtain to subrogation for a claim against City. 3.9 Verification of Coverage. Prior to commencement of any work, Contractor/Service Provider shall furnish City with original certificates of insurance and any amendatory endorsements necessary to demonstrate to City that Contractor/Service Provider has obtained the Required Insurance in compliance with the terms of this Agreement. The words “will endeavor” and “but failure to mail such notice shall impose no obligation or liability of any kind upon the company, its agents, or representatives” or any similar language must be deleted from all certificates. The required certificates and endorsements should otherwise be on industry standard forms. The City reserves the right to require, at any time, complete, certified copies of all required insurance policies, including endorsements evidencing the coverage required by these specifications. 3.10 Claims Made Policy Requirements. If General Liability, Pollution and/or Asbestos Pollution Liability and/or Errors & Omissions coverage are required and are provided on a claims-made form, the following requirements also apply: a.The “Retro Date” must be shown, and must be before the date of this Agreement or the beginning of the work required by this Agreement. b. Insurance must be maintained, and evidence of insurance must be provided, for at least five (5) years after completion of the work required by this Agreement. c. If coverage is canceled or non-renewed, and not replaced with another claims-made policy form with a “Retro Date” prior to the effective date of this Agreement, the Contractor/Service Provider must purchase “extended reporting” coverage for a minimum of five (5) years after completion of the work required by this Agreement. d. A copy of the claims reporting requirements must be submitted to the City for review. 3.11 Not a Limitation of Other Obligations. Insurance provisions under this section shall not be construed to limit the Contractor/Service Provider’s obligations under this Agreement, including Indemnity. 3.12 Additional Coverage. To the extent that insurance coverage provided by Contractor/Service Provider maintains higher limits than the minimums appearing in Exhibit B, City requires and shall be entitled to coverage for higher limits maintained. Page 541 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൦ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 4. INDEMNIFICATION 4.1. General. To the maximum extent allowed by law, Contractor/Service Provider shall protect, defend, indemnify and hold harmless City, its elected and appointed officers, agents, employees and volunteers (collectively, “Indemnified Parties”), from and against any and all claims, demands, causes of action, costs, expenses, (including reasonable attorneys’ fees and court costs), liability, loss, damage or injury, in law or equity, to property or persons, including wrongful death, in any manner arising out of or incident to any alleged acts, omissions, negligence, or willful misconduct of Contractor/Service Provider, its officials, officers, employees, agents, and contractors, arising out of or in connection with the performance of the Required Services, the results of such performance, or this Agreement. This indemnity provision does not include any claims, damages, liability, costs and expenses arising from the sole negligence or willful misconduct of the Indemnified Parties. Also covered is liability arising from, connected with, caused by or claimed to be caused by the active or passive negligent acts or omissions of the Indemnified Parties which may be in combination with the active or passive negligent acts or omissions of the Contractor/Service Provider, its employees, agents or officers, or any third party. 4.2. Modified Indemnity Where Agreement Involves Design Professional Services. Notwithstanding the forgoing, if the services provided under this Agreement are design professional services, as defined by California Civil Code section 2782.8, as may be amended from time to time, the defense and indemnity obligation under Section 1, above, shall be limited to the extent required by California Civil Code section 2782.8. 4.3 Costs of Defense and Award. Included in Contractor/Service Provider’s obligations under this Section 4 is Contractor/Service Provider’s obligation to defend, at Contractor/Service Provider’s own cost, expense and risk, any and all suits, actions or other legal proceedings that may be brought or instituted against one or more of the Indemnified Parties. Subject to the limitations in this Section 4, Contractor/Service Provider shall pay and satisfy any judgment, award or decree that may be rendered against one or more of the Indemnified Parties for any and all related legal expenses and costs incurred by any of them. 4.4. Contractor/Service Provider’s Obligations Not Limited or Modified. Contractor/Service Provider’s obligations under this Section 4 shall not be limited to insurance proceeds, if any, received by the Indemnified Parties, or by any prior or subsequent declaration by the Contractor/Service Provider. Furthermore, Contractor/Service Provider’s obligations under this Section 4 shall in no way limit, modify or excuse any of Contractor/Service Provider’s other obligations or duties under this Agreement. 4.5. Enforcement Costs. Contractor/Service Provider agrees to pay any and all costs City incurs in enforcing Contractor/Service Provider’s obligations under this Section 4. 4.6 Survival. Contractor/Service Provider’s obligations under this Section 4 shall survive the termination of this Agreement. 5.FINANCIAL INTERESTS OF CONTRACTOR/SERVICE PROVIDER. 5.1 Form 700 Filing. The California Political Reform Act and the Chula Vista Conflict of Interest Code require certain government officials and Contractor/Service Providers performing work for government agencies to publicly disclose certain of their personal assets and income using a Statement of Economic Interests form (Form 700). In order to assure compliance with these requirements, Contractor/Service Provider shall comply with the disclosure requirements identified in the attached Exhibit C, incorporated into the Agreement by this reference. Page 542 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൧ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 5.2 Disclosures; Prohibited Interests. Independent of whether Contractor/Service Provider is required to file a Form 700, Contractor/Service Provider warrants and represents that it has disclosed to City any economic interests held by Contractor/Service Provider, or its employees or subcontractors who will be performing the Required Services, in any real property or project which is the subject of this Agreement. Contractor/Service Provider warrants and represents that it has not employed or retained any company or person, other than a bona fide employee or approved subcontractor working solely for Contractor/Service Provider, to solicit or secure this Agreement. Further, Contractor/Service Provider warrants and represents that it has not paid or agreed to pay any company or person, other than a bona fide employee or approved subcontractor working solely for Contractor/Service Provider, any fee, commission, percentage, brokerage fee, gift or other consideration contingent upon or resulting from the award or making of this Agreement. Contractor/Service Provider further warrants and represents that no officer or employee of City, has any interest, whether contractual, non-contractual, financial or otherwise, in this transaction, the proceeds hereof, or in the business of Contractor/Service Provider or Contractor/Service Provider’s subcontractors. Contractor/Service Provider further agrees to notify City in the event any such interest is discovered whether or not such interest is prohibited by law or this Agreement. For breach or violation of any of these warranties, City shall have the right to rescind this Agreement without liability. 6. REMEDIES 6.1 Termination for Cause. If for any reason whatsoever Contractor/Service Provider shall fail to perform the Required Services under this Agreement, in a proper or timely manner, or if Contractor/Service Provider shall violate any of the other covenants, agreements or conditions of this Agreement (each a “Default”), in addition to any and all other rights and remedies City may have under this Agreement, at law or in equity, City shall have the right to terminate this Agreement by giving five (5) days written notice to Contractor/Service Provider. Such notice shall identify the Default and the Agreement termination date. If Contractor/Service Provider notifies City of its intent to cure such Default prior to City’s specified termination date, and City agrees that the specified Default is capable of being cured, City may grant Contractor/Service Provider up to ten (10) additional days after the designated termination date to effectuate such cure. In the event of a termination under this Section 6.1, Contractor/Service Provider shall immediately provide City any and all ”Work Product” (defined in Section 7 below) prepared by Contractor/Service Provider as part of the Required Services. Such Work Product shall be City’s sole and exclusive property as provided in Section 7 hereof. Contractor/Service Provider may be entitled to compensation for work satisfactorily performed prior to Contractor/Service Provider’s receipt of the Default notice; provided, however, in no event shall such compensation exceed the amount that would have been payable under this Agreement for such work, and any such compensation shall be reduced by any costs incurred or projected to be incurred by City as a result of the Default. 6.2 Termination or Suspension for Convenience of City. City may suspend or terminate this Agreement, or any portion of the Required Services, at any time and for any reason, with or without cause, by giving specific written notice to Contractor/Service Provider of such termination or suspension at least fifteen (15) days prior to the effective date thereof. Upon receipt of such notice, Contractor/Service Provider shall immediately cease all work under the Agreement and promptly deliver all “Work Product” (defined in Section 7 below) to City. Such Work Product shall be City's sole and exclusive property as provided in Section 7 hereof. Contractor/Service Provider shall be entitled to receive just and equitable compensation for this Work Product in an amount equal to the amount due and payable under this Agreement for work satisfactorily performed as of the date of the termination/suspension notice plus any additional remaining Required Services requested or approved by City in advance that would maximize City’s value under the Agreement. Page 543 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൨ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 6.3 Waiver of Claims. In the event City terminates the Agreement in accordance with the terms of this Section, Contractor/Service Provider hereby expressly waives any and all claims for damages or compensation as a result of such termination except as expressly provided in this Section 6. 6.4 Administrative Claims Requirements and Procedures. No suit or arbitration shall be brought arising out of this Agreement against City unless a claim has first been presented in writing and filed with City and acted upon by City in accordance with the procedures set forth in Chapter 1.34 of the Chula Vista Municipal Code, as same may be amended, the provisions of which, including such policies and procedures used by City in the implementation of same, are incorporated herein by this reference. Upon request by City, Contractor/Service Provider shall meet and confer in good faith with City for the purpose of resolving any dispute over the terms of this Agreement. 6.5 Governing Law/Venue. This Agreement shall be governed by and construed in accordance with the laws of the State of California. Any action arising under or relating to this Agreement shall be brought only in San Diego County, State of California. 6.6 Service of Process. Contractor/Service Provider agrees that it is subject to personal jurisdiction in California. If Contractor/Service Provider is a foreign corporation, limited liability company, or partnership that is not registered with the California Secretary of State, Contractor/Service Provider irrevocably consents to service of process on Contractor/Service Provider by first class mail directed to the individual and address listed under “For Legal Notice,” in section 1.B. of Exhibit A to this Agreement, and that such service shall be effective five days after mailing. 7. OWNERSHIP AND USE OF WORK PRODUCT All reports, studies, information, data, statistics, forms, designs, plans, procedures, systems and any other materials or properties produced in whole or in part under this Agreement in connection with the performance of the Required Services (collectively “Work Product”) shall be the sole and exclusive property of City. No such Work Product shall be subject to private use, copyrights or patent rights by Contractor/Service Provider in the United States or in any other country without the express, prior written consent of City. City shall have unrestricted authority to publish, disclose, distribute, and otherwise use, copyright or patent, in whole or in part, any such Work Product, without requiring any permission of Contractor/Service Provider, except as may be limited by the provisions of the Public Records Act or expressly prohibited by other applicable laws. With respect to computer files containing data generated as Work Product, Contractor/Service Provider shall make available to City, upon reasonable written request by City, the necessary functional computer software and hardware for purposes of accessing, compiling, transferring and printing computer files. 8. GENERAL PROVISIONS 8.1 Amendment. This Agreement may be amended, but only in writing signed by both Parties. 8.2 Assignment. City would not have entered into this Agreement but for Contractor/Service Provider’s unique qualifications and traits. Contractor/Service Provider shall not assign any of its rights or responsibilities under this Agreement, nor any part hereof, without City’s prior written consent, which City may grant, condition or deny in its sole discretion. 8.3 Authority. The person(s) executing this Agreement for Contractor/Service Provider warrants and represents that they have the authority to execute same on behalf of Contractor/Service Provider and to bind Page 544 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൩ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Contractor/Service Provider to its obligations hereunder without any further action or direction from Contractor/Service Provider or any board, principle or officer thereof. 8.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed an original, but all of which shall constitute one Agreement after each Party has signed such a counterpart. 8.5 Entire Agreement. This Agreement together with all exhibits attached hereto and other agreements expressly referred to herein, constitutes the entire Agreement between the Parties with respect to the subject matter contained herein. All exhibits referenced herein shall be attached hereto and are incorporated herein by reference. All prior or contemporaneous agreements, understandings, representations, warranties and statements, oral or written, are superseded. 8.6 Record Retention. During the course of the Agreement and for three (3) years following completion of the Required Services, Contractor/Service Provider agrees to maintain, intact and readily accessible, all data, documents, reports, records, contracts, and supporting materials relating to the performance of the Agreement, including accounting for costs and expenses charged to City, including such records in the possession of sub-contractors/sub-Contractor/Service Providers. 8.7 Further Assurances. The Parties agree to perform such further acts and to execute and deliver such additional documents and instruments as may be reasonably required in order to carry out the provisions of this Agreement and the intentions of the Parties. 8.8 Independent Contractor. Contractor/Service Provider is and shall at all times remain as to City a wholly independent contractor. Neither City nor any of its officers, employees, agents or volunteers shall have control over the conduct of Contractor/Service Provider or any of Contractor/Service Provider’s officers, employees, or agents (“Contractor/Service Provider Related Individuals”), except as set forth in this Agreement. No Contractor/Service Provider Related Individuals shall be deemed employees of City, and none of them shall be entitled to any benefits to which City employees are entitled, including but not limited to, overtime, retirement benefits, worker's compensation benefits, injury leave or other leave benefits. Furthermore, City will not withhold state or federal income tax, social security tax or any other payroll tax with respect to any Contractor/Service Provider Related Individuals; instead, Contractor/Service Provider shall be solely responsible for the payment of same and shall hold the City harmless with respect to same. Contractor/Service Provider shall not at any time or in any manner represent that it or any of its Contractor/Service ProviderRelated Individuals are employees or agents of City. Contractor/Service Provider shall not incur or have the power to incur any debt, obligation or liability whatsoever against City, or bind City in any manner. 8.9 Notices. All notices, demands or requests provided for or permitted to be given pursuant to this Agreement must be in writing. All notices, demands and requests to be sent to any Party shall be deemed to have been properly given or served if personally served or deposited in the United States mail, addressed to such Party, postage prepaid, registered or certified, with return receipt requested, at the addresses identified in this Agreement at the places of business for each of the designated Parties as indicated in Exhibit A, or otherwise provided in writing. 8.10 Electronic Signatures. Each Party agrees that the electronic signatures, whether digital or encrypted, of the Parties included in this Agreement are intended to authenticate this writing and to have the same force and effect as manual signatures. Electronic Signature means any electronic sound, symbol, or process attached to or logically associated with a record and executed and adopted by a Party with the intent to sign such record, Page 545 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡൠ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 including facsimile or email electronic signatures, pursuant to the California Uniform Electronic Transactions Act (Cal. Civ. Code §§ 1633.1 to 1633.17) as amended from time to time. (End of page. Next page is signature page.) Page 546 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡൡ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 SIGNATURE PAGE CONTRACTOR/SERVICE PROVIDER SERVICES AGREEMENT IN WITNESS WHEREOF, by executing this Agreement where indicated below, City and Contractor/Service Provider agree that they have read and understood all terms and conditions of the Agreement, that they fully agree and consent to bound by same, and that they are freely entering into this Agreement as of the Effective Date. NOVA COMMERCIAL CITY OF CHULA VISTA BY:________________________________BY: ________________________________ SOPHIA SILVA MARY CASILLAS SALAS CEO MAYOR ATTEST BY: ________________________________ Kerry K. Bigelow, MMC City Clerk APPROVED AS TO FORM BY: ________________________________ Glen R. Googins City Attorney Page 547 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡൢ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 EXHIBIT A SCOPE OF WORK AND PAYMENT TERMS 1. Contact People for Contract Administration and Legal Notice A. City Contract Administration: Stephen Mosca 1800 Maxwell, Chula Vista, CA 91911 619-397-6149 smosca@chulavistaca.gov For Legal Notice Copy to: City of Chula Vista City Attorney 276 Fourth Avenue, Chula Vista, CA 91910 619-691-5037 CityAttorney@chulavistaca.gov B. Contractor/Service Provider Contract Administration: NOVA COMMERCIAL 2573 Market Street 619-666-9095 eleanor@Novagbc.com For Legal Notice Copy to: Sophia Silva 2573 Market Street 619-666-9095 sophia@noacommercial.com 2. Required Services A. General Description: SPECIFICATIONS FOR JANITORIAL SERVICES FOR MULTIPLE CITY FACILITIES NOVA COMMERCIAL will provide janitorial services for multiple City facilities as outlined below. Additional facilities may be added/ amended upon written mutual agreement. 1. General Specifications Contractor shall provide and/or purchase all equipment, labor and materials required to perform the following services in a satisfactory manner: a. Contractor shall perform a baseline cleaning of the facilities listed below. This baseline cleaning will remove all visible spots, discoloring, smudges, dust, and all other filth from all areas high and low. This baseline cleaning will establish the model for all cleanings during the term of this contract. Page 548 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡൣ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 b. Contractor shall provide janitorial services for the City of Chula Vista facilities listed in this document. c. Contractor shall provide and/or purchase all services, products, equipment, vehicles, and employees as defined in this document. d. Contractor shall adhere to all scheduling as defined in this document unless a schedule change has been approved by the City in writing. e. Contractor shall provide additional janitorial services, as needed, and as defined by change order(s) or proposal(s) for events and/or special considerations for the City of Chula Vista. f. Contractor shall maintain a current City of Chula Vista business license, and their subcontractors shall do so as well. g. Contractor shall present a professional image and maintain a high standard of qualityand technical competence. Total responsibility for this is placed upon the Contractor. B. Detailed Description: 1.Contractor will provide the following services: The Contractor shall send a Daily Attendance Roster, which is to include all missing staff members, to the Building Services Manager by 9:00 a.m. each working day. Failure to complete the work as scheduled or as specified herein will result in the following actions: a. The sum of Two Hundred Fifty Dollars ($250) per day will be deducted by the City and be forfeited by the Contractor from payments to the Contractor for each instance where an item of work is not completed in accordance with schedule or specifications. b. Deficiencies: An additional amount equal to the costs incurred by completion of the work by an alternate source, whether it be City forces or separate private contractor, even if it exceeds the contract unit price, will be deducted. c. The actions outlined in “a”and “b”above shall not be construed as penalty but as adjustment of payment to the Contractor for only the work actually performed or as the cost to the City for inspection and other related costs from the failure by the Contractor to complete the work according to schedule. 2. Company Employees and Vehicles d. Contractor will supply a pool of employees sufficient to meet the agency’s needs. e. Contractor will provide or pay for their employees to wear clean, neat appearing uniforms that will be worn while working on City premises. Uniforms will consist of a polo shirt or other collared shirt with name tag and Contractor’s identification and full- length work pants. f. Contractor and their employees will be courteous and show respect to the public, City employees and other Contractor employees at all times. Use a friendly voice tone and offer assistance when necessary. Page 549 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ൤ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 g. Contractor and their employees will need to complete and pass a CJIS level vendor employee background,including aLive Scan, and sign amandatory CJISdocument to haveunescortedaccess within the Police Department. h. NOVA COMMERCIAL will provide a list of employees (applicants) that will be working within the Police building to the Chula Vista Police Department Backgrounds Unit. The list shall include the employee name, date of birth, phone number, and email address. ABackground Investigator will contact the employee with directions on scheduling a Live Scan and completing a backgrounds information packet. i. Once the applicant has been live scanned (fingerprinted), the Chula Vista Police Department must wait for a response from the Department of Justice. j. The Department of Justice may send the Chula Vista Police Department a 30-day, 60-day or 90-day delay on the applicant. The City has no control over these delays. This occurs when applicants have common names, have been previously permitted, or have prior criminal history or arrest information on file. No applicants will be approved and no issuance of keys, security codes, or access information for any City facility will be provided by the contractor or the City to the applicant until all information has been received from the Department of Justice and that applicant cleared by the City and a City of Chula Vista contractor identification card issued. k. Contractor will pay the $52 fee for Live Scan for each employee working within City facilities. l. The employee will be placed on subsequent notification. This requirement allows the department to receive notification of any arrest after the Live Scan check. m. Contractor is responsible for their employees’ actions on these sites. n. Contractor will ensure that their employees do not have other “unapproved” personnel including children in the facilities or in the Contractor’s vehicles outside the facility. o. Contractor will ensure that their employees do not store personal property of any kind in or on City facilities. p. Contractor will not issue, loan or otherwise allow the procurement of keys, access information, or codes to anyone, including employees, without first receiving authorization from the City Representative and without first successfully completing the background check and Live Scan and submitting said documentation to the City Representative. q. Contracted employees will refrain from making or receiving personal calls during working hours. Non- emergency calls should be made during breaks or lunch. 3. Building Security a. Report to the CityRepresentative in writing anywalls, rooms, carpeting, equipment and furniture damaged by vandalism, graffiti, stains, water leaks, etc. b. Secure and lock all doors before leaving unoccupied buildings. Page 550 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ൥ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 c. Turn off all lights not left on for security reasons as instructed. d. Activate intrusion alarm security systems after completing work and before leaving buildings. e. Deactivate security systems before entering buildings at the beginning of work as instructed and where applicable. f. Report in writing to the City Representative security system false alarms activated by Contractor’s employees or otherwise occurring during janitorial service when no City employee is present. g. Provide to the City Representative a list of the keys and codes issued to Contractor’s employees. This list will include employee names, addresses and telephone numbers that these codes and keys are issued to. Contractor will notify the City Representative of all and any keys or other pass code information lost by Contractor’s employees. h. Contractor shall not duplicate keys without first receiving written permission from the City Representative. i. Contractor is responsible for retrieving all City security information from those employees no longer employed by the Contractor, for whatever reason. j. Contractor will notify the City Representative within 24 hours in writing of any Contractor employee whose employment has been terminated that has or has had City security information or appurtenances. k. Contractor is responsible for the cost of any re-keying, entry code, or security code changes needed due to non-retrieval of this security information, keys or appurtenances from their past employees. 4. City Holiday Schedule TheCityofChulaVista’s public offices will be closed in observation of the following holidays. The Libraries and Recreation Center sites will not be cleaned on these dates: • New Year’s Day • Martin Luther King, Jr. Day • Cesar Chavez Day • Memorial Day • Independence Day • Labor Day • Veterans’Day • Thanksgiving Day (and the day after) • Christmas Day Services will continue to be provided at the Police Department on City Holidays. Page 551 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ൦ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 5. Tasks a. Contractor will separate all recyclable material from other refuse and deposit in appropriate receptacle at each facilities serviced location. b. Contractor will leave each facility visually clean having wiped, spot removed, dusted mopped, vacuumed, emptied or otherwise cleaned each area per this document to the standards defined within this document, industry standard and City expectation. c. The following is a guideline for cleaning these areas as defined in this document. The intent of this document is to find these areas visually clean, all hard surfaces sanitized, all fabrics unstained, vacuumed and ready for use upon entry every day. All areas should smell clean but should not have a bold cleanser smell upon entry. Police Department –Excluding Jail Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Sweep receiving area Weekly Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Page 552 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ൧ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items Weekly Arrange chairs as needed Daily Sanitize and polish water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Other Services Evening trash pick-up from Jail Daily Page 553 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ൨ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 High dust common areas and offices Monthly Clean lobby windows (inside and outside)Monthly Scrub restroom floors Monthly Buff hard floors Monthly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual Police Department –Jail Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Page 554 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൡ൩ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items weekly Arrange chairs as needed Daily Sanitize water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Page 555 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢൠ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Sanitize appliances Daily Other Services Cell and shower area sanitation with high pressure washer –rotating Weekly High dust common areas and offices Monthly Clean lobby windows (inside and outside)Monthly Scrub restroom floors Monthly Buff hard floors Monthly Routine cleaning of walk in fridge and oven in kitchen area Bi-monthly Deep freeze defrost and cleaning Quarterly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual Libraries –Civic Center Branch, South Chula Vista, and Otay Ranch Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Page 556 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢൡ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items weekly Arrange chairs as needed Daily Sanitize water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Page 557 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢൢ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Other Services High dust common areas and offices Monthly Clean lobby windows (inside and outside)Monthly Scrub restroom floors Monthly Buff hard floors Monthly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual Recreation Center –Heritage and Veterans Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Page 558 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢൣ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Sweep entry Daily Disinfect high touch surface Daily Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items weekly Arrange chairs as needed Daily Sanitize water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Page 559 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ൤ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Other Services High dust common areas and offices Monthly Clean lobby windows (inside and outside)Monthly Scrub restroom floors Monthly Buff hard floors Monthly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual 6. Products a. Contractor will maintain an adequate inventory of janitorial supplies, products and equipment sufficient to meet the agency’s needs. The City will provide paper products, the contractor will provide cleaning products and related janitorial equipment. Page 560 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ൥ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 b. Contractor will replenish on each service date all products used in that facility. At the end of each service, each location will have extra supplies of two cases of toilet tissue and paper hand towels, an ample supply of each additional paper product, two cans of each spray product applicable, two gallons of each floor cleaning chemical product used at that facility, two gallons of liquid hand cleaner, two gallons of window cleaner, two gallons of sanitizer, and all other cleaning appurtenances in good condition such as, but not limited to - broom, clean mop, bucket and wringer, dust pan, fox tail brush, toilet brush, and other cleaning items. c. Some sites have limited storage capability. It is the contractor’s responsibility to supply, provide and store products for the service of these areas in a manner that serves the City best at the discretion of the City Representative. d. With the above exception, all other products will be stored off site. No items other than those shown will be stored in the City facility. e. All products will meet or exceed the City’s s pecifications. f. All products proposed for use bythe Contractor on any site covered by this contract will first be approved through the submittal process as defined within this document. The City will not pay any additional costs for Contractor requested substitutions when the City listed approved products are still available. The City reserves the right to approve or disapprove any product. g. All products will be removed from boxes and stowed neatly on shelves and racks for easy access and inventory. h. Contractor will provide the City with Safety Data Sheet(s) (SDS) information on all product submittals. i. Contractor is responsible for providing SDS information to their employees. j. Previously used products list: DESCRIPTION SUPPLIER 1. Glass Cleaner Waxie 2. Stainless Steel Cleaner Waxie 3. Neutral Floor Cleaner Waxie 4. General Restroom Disinfectant Waxie 5. Urinal Deodorized Screens Waxie 6.General Multipurpose Cleaner Waxie 7.Furniture Polish Waxie 8. Industrial Degreaser Waxie 9. Floor Sealant/Wax and Floor Stripper Waxie 10. Bathroom Tile Cleaner Waxie 11.Toilet Bowl and Fixture Cleaner (Mild acid based)Waxie 12.Solsta Dilution System Waxie Page 561 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ൦ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 All Cleaning products (if available) will be green based and must be approved by the City of Chula vista before use at city facilities. 7. Equipment a. Contractor will supply and maintain all tools and equipment in good and proper working condition, such as clean mops, brooms, bucket and wringers, carts, dust pans, dusters, vacuum cleaners, janitorial vehicles, cleaning supplies and chemicals, and secure an adequate inventory of all janitorial supplies and products. b. All equipment provided by the Contractor will be of commercial grade. c. Contractor will supply each facility two mops, a “clean mop” for kitchens, lunchrooms, prep areas, etc. and another mop for all other areas and incidental cleanups. d. “Clean mops”will be marked so that employees of the City as well as Contractor’s employees can easily recognize these tools as clean. e. Contractor will replace all mops as needed to ensure adequate, sanitary cleaning. f. All equipment stored on site at a City facility will be stored neatly and orderly. All Janitors closets will be stowed in such a way that City employees can easily find what is needed, during their work shift, without moving other items - except for the janitorial cart. All mops, brooms, dust pans, and other cleaning appurtenances will be either hung or shelved neatly when they are stored. g. Any storage shelf/ cabinet units needed for the storage of the supplies as described in this document at any facility listed is subject to the approval process in section 9 (submittals). Once approved, the shelf unit will be installed by the City. h. Any rack systems needed for storage of other janitorial equipment as described in this document at any facility listed is subject to the approval process in section 9 (submittals). i. Any chemical dispensing unit/equipment and appurtenances that the Contractor finds critical to their operationis subject to the approval process in section 9(submittals). Purchase, assembly, and installation will be done, contracted, or coordinated by the Contractor at their expense and under the direction of City staff. This is not a reimbursable item. 8. Submittals a. All materials and consumable products are subject to prior approval by the City’s Representative. Contractor will provide submittals for the following items to the City’s Representative for approval. All materials and consumable products used at these project sites will be subject to prior approval through this submittal application process. No materials will be accepted for use on this project without prior approval in writing. All submittals will have the appropriate MSDS attached for City review. b. Any Contractor requested replacements/ substitutions for the items listed in “PRE-APPROVED PRODUCTS”are subject to this approval process. Page 562 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ൧ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 9. Service Adjustments The City reserves the right to increase or decrease the services as needed. Services and fees for new facilities shall be added at the average rate per square foot for a comparable facility at the time of the addition. Such changes will be according to the terms and conditions of said bid specification and will be done through a duly authorized change notice to the master agreement for regular service and by City-approved proposal for event or special cleanings. 10. Site Inspection and Reporting a. Report immediately by telephone (during regular working hours (619) 397-6000, after hours issues call Chula Vista Police Department dispatch at (619) 691-5151) anyissues that may require immediate action. For emergencies call 911. i. Incidents of injury, damage or potential hazards to the public, end users or employees. ii. Running water (roof leaks, faucet leaks, ceiling leaks) iii. Power outages or light bulb replacement iv. Sewer and drain backups or clogging and foul smells and odors v. Ceiling tile stains and deformation b. Report immediately by e-mail issues such as, but not limited to: i. Public nuisances ii. Work performance delays iii. Repairs needed iv. Dripping water v. Non-emergency electrical issues such as, but not limited to, outlets without power or entire buildings without power. vi. Lost and found articles 1) Deliver any lost and found article from the Library to the Library Administrative Secretary that date. 2) Deliver any lost and found article from the Police Department to the Watch Commander 11. Payments a. Contractor will submit amonthly payment invoice listing each of the facilities serviced and each individual invoice amount. b. If the City determines that there are deficiencies in the performance of this contract, the Contractor will be notified both verbally and in writing each time service requirements are found to be unsatisfactory and corrective action is necessary. Should the Contractor fail to correct any deficiencies within 12 hours, the City may exercise the following measures: i. Deduct from the Contractor’s payment the amount necessary to correct the deficiency. ii. Withhold the entire or partial payment. iii. Utilize City forces or alternate source to correct the deficiency and deduct from the Contractor’s payment the total cost, including City overhead. c. Invoices will be submitted to the Building Services Supervisor Page 563 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ൨ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 City of Chula Vista Public Works 1800 Maxwell Road Chula Vista, CA 91911 12. Quality Assurance Contractor is responsible for training, supervising, equipping, checking work quality, ensuring adherence to schedule, and all other management issues involved with their employees. Quality control is the responsibility of the Contractor. 3. Term:In accordance with Section 1.10 of this Agreement, the term of this Agreement shall begin July 1, 2022 and end on June 30, 2023 with the option to extend for four (4) one-year extensions for completion of all Required Services. 4. Compensation: A. Form of Compensation ܈ Fixed Fee Paid in Monthly Increments. For the completion of each Deliverable of the Required Services, as identified in section 2.B., above, City shall pay the fixed fee associated with each Deliverable, in the amounts set forth below: CONTRACTOR agrees to provide all labor necessary to perform custodial services for the following facilities in accordance with the provisions and specifications listed in this Agreement. All paper-based products and hand-soaps shall be purchased by the City. Base Line Cleaning Services Labor Pricing ACTIVITY PER HOUR COST Labor, Hourly Rate DURING Regular Work Hours (M-F 6:00 am to 5:00 pm)$30.00 Labor, Hourly Rate AFTER Regular Work Hours $34.50 Location Time of Service Staffing/ Hours Est. Square Footage Monthly Cost Chula Vista Police Department (excluding Jail) 4:00 am to 12:30 pm Monday to Friday 8:00 am to 5:00 pm Monday to Friday 6:00 am to 2:30 pm Weekends and City Holidays 1 staff - 8 hours 1 staff –8 hours each 1 staff –8 hours each 132,374 square feet interior (gross) 150,314 square feet garage 8,517 exterior walkways $9,324.00 Page 564 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൢ൩ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Chula Vista Police Department –Jail 4:00 am to 12:30 pm Monday to Friday 1 staff - 8 hours 16,000 square feet $3,790.00 Chula Vista Library – Civic Center Branch 8:00 am to 4:30 pm Monday to Friday 8:00 am to 12:30 pm Saturday and Sunday 1 staff - 8 hours each 1 staff –4 hours each 71,085 square feet $4,736.00 Chula Vista Library South Branch 8:00 am to 4:30 pm Monday to Friday 8:00 am to 12:30 pm Saturday and Sunday 1 staff - 8 hours each 1 staff –4 hours each 38,614 square feet $4,736.00 Chula Vista Library – Otay Ranch Branch 6:00 am to 8:00 am Monday to Friday 1 staff - 2 hours each 3,900 square feet $925.00 Recreation Center – Veterans 10:00 am to 2:00 pm Sunday to Thursday 1 staff -4 hours each 15,885 square feet $1,949.00 Recreation Center – Heritage 8:00 am to 10:00 am Sunday to Thursday 1 staff - 2 hours each 6,000 square feet $950.00 Monthly Total:$26,410 Note: Services for Libraries and Recreation Centers –Libraries and Recreation Centers are currently restricted due to COVID-19 protocols. Hours of operation may be increased as restrictions are modified. Work Schedule - The Contractor shall accomplish all janitorial services based on the schedule noted above. Contractor shall adhere to all scheduling as defined in this document unless a schedule change has been approved by the City in writing. B. Reimbursement of Costs ܈ Invoiced or agreed-upon amounts as follows: Monthly costs per Facility are included on the table above. In addition, the City may use the Contractor for the following Services at the rates noted below: Additional Window Cleaning Cost per Sq. Ft.$0.75 Additional Carpet Shampooing Cost per Sq. Ft.$0.12 Stripping and Waxing Service Cost per Sq. Ft.$0.25 Additional Cleanup Services (regular working hours)Cost per Hour $30.00 Additional Cleanup Services (call-backs for after-hours, weekends and holidays with one (1) hour response time)Cost per Hour $34.50 Page 565 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൣൠ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 Notwithstanding the foregoing, the maximum amount to be paid to the Contractor/Service Provider for services performed through June 30, 2023 shall not exceed $380,000.00 for fiscal year 2022-23 and $2,250,000 for the total term of the Agreement (5-years). 5. Special Provisions: ܈ Permitted Sub-Contractor/Service Providers: “None” ܈ Security for Performance: In the event that Exhibit A Section 4 indicates the need for Contractor/Service Provider to provide additional security for performance of its duties under this Agreement, Contractor/Service Provider shall provide such additional security prior to commencement of its Required Services in the form and on the terms prescribed on Exhibit A, or as otherwise prescribed by the City Attorney. ܈ Notwithstanding the completion date set forth in Section 3 above, City has option to extend this Agreement for four (4) additional terms, defined as a one-year increment or n/a. The City Manager or Director of Finance/Treasurer shall be authorized to exercise the extensions on behalf of the City. If the City exercises an option to extend, each extension shall be on the same terms and conditions contained herein, provided that the amounts specified in Section 4 above may be increased by up to the rate of inflation as reflected by the San Diego Consumer Price Index (“CPI”) –for Urban Wage Earners and Clerical Workers (CPI-W), up to a maximum increase of 5% for any one (1) additional term for each extension. The City shall give written notice to Contractor/Service Provider of the City’s election to exercise the extension via the Notice of Exercise of Option to Extend document. Such notice shall be provided at least 30 days prior to the expiration of the term. ܆ None Page 566 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൣൡ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 EXHIBIT B INSURANCE REQUIREMENTS Contractor/Service Provider shall adhere to all terms and conditions of Section 3 of the Agreement and agrees to provide the following types and minimum amounts of insurance, as indicated by checking the applicable boxes (x). Type of Insurance Minimum Amount Form ܈ General Liability: Including products and completed operations, personal and advertising injury $2,000,000 per occurrence for bodily injury, personal injury (including death), and property damage. If Commercial General Liability insurance with a general aggregate limit is used, either the general aggregate limit must apply separately to this Agreement or the general aggregate limit must be twice the required occurrence limit Additional Insured Endorsement or Blanket AI Endorsement for City* Waiver of Recovery Endorsement Insurance Services Office Form CG 00 01 *Must be primary and must not exclude Products/Completed Operations ܆ Automobile Liability $1,000,000 per accident for bodily injury, including death, and property damage Insurance Services Office Form CA 00 01 Code 1-Any Auto Code 8-Hired Code 9-Non Owned ܈ Workers’ Compensation Employer’s Liability $1,000,000 each accident $1,000,000 disease policy limit $1,000,000 disease each employee Waiver of Recovery Endorsement Other Negotiated Insurance Terms: ENTER ANY ADDITIONAL TERMS OR “NONE” Page 567 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ൣൢ City of Chula Vista Agreement No.: 2022-044 Service Provider Name: NOVA COMMERCIAL Rev. 2/4/21 EXHIBIT C CONTRACTOR/SERVICE PROVIDER CONFLICT OF INTEREST DESIGNATION The Political Reform Act1 and the Chula Vista Conflict of Interest Code2 (“Code”) require designated state and local government officials, including some Contractor/Service Providers, to make certain public disclosures using a Statement of Economic Interests form (Form 700). Once filed, a Form 700 is a public document, accessible to any member of the public. In addition, Contractor/Service Providers designated to file the Form 700 are also required to comply with certain ethics training requirements.3 ܈ A. Contractor/Service Provider IS a corporation or limited liability company and is therefore EXCLUDED4 from disclosure. ܆ B. Contractor/Service Provider is NOT a corporation or limited liability company and disclosure designation is as follows: APPLICABLE DESIGNATIONS FOR INDIVIDUAL(S) ASSIGNED TO PROVIDE SERVICES (Category descriptions available at www.chulavistaca.gov/departments/city-clerk/conflict-of-interest-code.) Name Email Address Applicable Designation Enter Name of Each Individual Who Will Be Providing Service Under the Contract –If individuals have different disclosure requirements, duplicate this row and complete separately for each individual Enter email address(es)܆ A. Full Disclosure ܆ B. Limited Disclosure (select one or more of the categories under which the Contractor shall file): ܆ 1. ܆ 2. ܆ 3. ܆ 4. ܆ 5. ܆ 6. ܆ 7. Justification: ܆ C. Excluded from Disclosure 1.Required Filers Each individual who will be performing services for the City pursuant to the Agreement and who meets the definition of “Contractor/Service Provider,” pursuant to FPPC Regulation 18700.3, must file a Form 700. 2.Required Filing Deadlines Each initial Form 700 required under this Agreement shall be filed with the Office of the City Clerk via the City's online filing system, NetFile, within 30 days of the approval of the Agreement. Additional Form 700 filings will be required annually on April 1 during the term of the Agreement, and within 30 days of the termination of the Agreement. 3. Filing Designation The City Department Director will designate each individual who will be providing services to the City pursuant to the Agreement as full disclosure, limited disclosure, or excluded from disclosure, based on an analysis of the services the Contractor/Service Provider will provide. Notwithstanding this designation or anything in the Agreement, the Contractor/Service Provider is ultimately responsible for complying with FPPC regulations and filing requirements. If you have any questions regarding filing requirements, please do not hesitate to contact the City Clerk at (619)691-5041, or the FPPC at 1-866-ASK-FPPC, or (866) 275-3772 *2. Pursuant to the duly adopted City of Chula Vista Conflict of Interest Code, this document shall serve as the written determination of the Contractor’s requirement to comply with the disclosure requirements set forth in the Code. Completed by: Stephen Mosca 1 Cal. Gov. Code §§81000 et seq.; FPPC Regs. 18700.3 and 18704. 2 Chula Vista Municipal Code §§2.02.010-2.02.040. 3 Cal. Gov. Code §§53234, et seq. 4 CA FPPC Adv. A-15-147 (Chadwick) (2015); Davis v. Fresno Unified School District (2015) 237 Cal.App.4th 261; FPPC Reg. 18700.3 (Consultant defined as an “individual” who participates in making a governmental decision; “individual” does not incl ude corporation or limited liability company). Page 568 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 FIRST AMENDMENT to Agreement between the City of Chula Vista and Nova Commercial For Janitorial Services for Multiple Facilities This FIRST AMENDMENT “Amendment” is entered into effective as of May 16, 2023 “Effective Date” by and between the City of Chula Vista (“City”) and Nova Commercial “Consultant” with reference to the following facts: RECITALS WHEREAS, City and Consultant previously entered into Attachment 2 Nova First Amendment to Agreement.docx “Original Agreement” on July 1, 2022; and WHEREAS, City and Consultant desire to amend the Agreement to add janitorial services at additional City facilities, increase the annual not to exceed amount for fiscal year 2023, amend the first term to include fiscal year 2024, and increase the total value of the agreement to $3,500,000) as more specifically set forth below; and WHEREAS, Section 8.1 of the Original Agreement provides that the parties are permitted to modify the Agreement by means of a written amendment executed by both Parties. NOW, THEREFORE, in consideration of the above recitals and the mutual obligations of the parties set forth herein, City and Consultant agree as follows: 1. Exhibit A of the Agreement, entitled Scope of Work and Payment Terms, is replaced in its entirety with Exhibit A to this First Amendment, entitled First Amended and Restated Scope of Work and Payment Term. 2. Except as expressly provided herein, all other terms and conditions of the Original Agreement shall remain in full force and effect. 3. Each party represents that it has full right, power and authority to execute this FIRST Amendment and to perform its obligations hereunder, without the need for any further action under its governing instruments, and the parties executing this Amendment on the behalf of such party are duly authorized agents with authority to do so. Page 569 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 SIGNATURE PAGE TO FIRST AMENDMENT TO ATTACHMENT 2 NOVA FIRST AMENDMENT TO AGREEMENT.DOCX NOVA COMMERCIAL CITY OF CHULA VISTA BY:________________________________ BY: ________________________________ SOPHIA SILVA JOHN MCCANN CEO MAYOR ATTEST BY: _________________________________ KERRY K. BIGELOW, MMC CITY CLERK APPROVED AS TO FORM BY: _______________________________ Jill D.S. Maland Lounsbery Ferguson Altona & Peak Acting City Attorney Page 570 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 EXHIBIT A FIRST AMENDED AND RESTATED SCOPE OF WORK AND PAYMENT TERMS 1. Contact People for Contract Administration and Legal Notice A. City Contract Administration: Stephen Mosca 1800 Maxwell Road, Chula Vista, CA 91911 619-397-6149 smosca@chulavistaca.gov For Legal Notice Copy to: City of Chula Vista City Attorney 276 Fourth Avenue, Chula Vista, CA 91910 619-691-5037 CityAttorney@chulavistaca.us B. Contractor/Service Provider Contract Administration: NOVA COMMERCIAL PO BOX 1435 National City, CA 91950 619-666-9095 eleanor@Novagbc.com For Legal Notice Copy to: Sophia Silva PO Box 1435 National City, CA 91950 619-666-9095 sophia@novacommercial.us 2. Required Services A. General Description: SPECIFICATIONS FOR JANITORIAL SERVICES FOR MULTIPLE CITY FACILITIES NOVA COMMERCIAL will provide janitorial services for multiple City facilities as outlined below. Additional facilities may be added/ amended upon written mutual agreement. 1. General Specifications Page 571 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Contractor shall provide and/or purchase all equipment, labor and materials required to perform the following services in a satisfactory manner: a. Contractor shall perform a baseline cleaning of the facilities listed below. This baseline cleaning will remove all visible spots, discoloring, smudges, dust, and all other filth from all areas high and low. This baseline cleaning will establish the model for all cleanings during the term of this contract. b. Contractor shall provide janitorial services for the City of Chula Vista facilities listed in this document. c. Contractor shall provide and/or purchase all services, products, equipment, vehicles, and employees as defined in this document. d. Contractor shall adhere to all scheduling as defined in this document unless a schedule change has been approved by the City in writing. e. Contractor shall provide additional janitorial services, as needed, and as defined by change order(s) or proposal(s) for events and/or special considerations for the City of Chula Vista. f. Contractor shall maintain a current City of Chula Vista business license, and their subcontractors shall do so as well. g. Contractor shall present a professional image and maintain a high standard of quality and technical competence. Total responsibility for this is placed upon the Contractor. B. Detailed Description: 1. Contractor will provide the following services: The Contractor shall send a Daily Attendance Roster, which is to include all missing staff members, to the Building Services Manager by 9:00 a.m. each working day. Failure to complete the work as scheduled or as specified herein will result in the following actions: a. The sum of Two Hundred Fifty Dollars ($250) per day will be deducted by the City and be forfeited by the Contractor from payments to the Contractor for each instance where an item of work is not completed in accordance with schedule or specifications. b. Deficiencies: An additional amount equal to the costs incurred by completion of the work by an alternate source, whether it be City forces or separate private contractor, even if it exceeds the contract unit price, will be deducted. c. The actions outlined in “a” and “b” above shall not be construed as penalty but as adjustment of payment to the Contractor for only the work actually performed or as the cost to the City for Page 572 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 inspection and other related costs from the failure by the Contractor to complete the work according to schedule. 2. Company Employees and Vehicles a. Contractor will supply a pool of employees sufficient to meet the agency’s needs. b. Contractor will provide or pay for their employees to wear clean, neat appearing uniforms that will be worn while working on City premises. Uniforms will consist of a polo shirt or other collared shirt with name tag and Contractor’s identification and full- length work pants. c. Contractor and their employees will be courteous and show respect to the public, City employees and other Contractor employees at all times. Use a friendly voice tone and offer assistance when necessary. d. Contractor and their employees will need to complete and pass a CJIS level vendor employee background, including a Live Scan, and sign a mandatory CJIS document to have unescorted access within the Police Department. e. Nova Commercial will provide a list of employees (applicants) that will be working within the Police building to the Chula Vista Police Department Backgrounds Unit. The list shall include the employee name, date of birth, phone number, and email address. A Background Investigator will contact the employee with directions on scheduling a Live Scan and completing a backgrounds information packet. f. Once the applicant has been live scanned (fingerprinted), the Chula Vista Police Department must wait for a response from the Department of Justice. g. The Department of Justice may send the Chula Vista Police Department a 30-day, 60-day or 90-day delay on the applicant. The City has no control over these delays. This occurs when applicants have common names, have been previously permitted, or have prior criminal history or arrest information on file. No applicants will be approved and no issuance of keys, security codes, or access information for any City facility will be provided by the contractor or the City to the applicant until all information has been received from the Department of Justice and that applicant cleared by the City and a City of Chula Vista contractor identification card issued. h. Contractor will pay the $52 fee for Live Scan for each employee working within City facilities. i. The employee will be placed on subsequent notification. This requirement allows the department to receive notification of any arrest after the Live Scan check. j. Contractor is responsible for their employees’ actions on these sites. k. Contractor will ensure that their employees do not have other “unapproved” personnel including children in the facilities or in the Contractor’s vehicles outside the facility. Page 573 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 l. Contractor will ensure that their employees do not store personal property of any kind in or on City facilities. m. Contractor will not issue, loan or otherwise allow the procurement of keys, access information, or codes to anyone, including employees, without first receiving authorization from the City Representative and without first successfully completing the background check and Live Scan and submitting said documentation to the City Representative. n. Contracted employees will refrain from making or receiving personal calls during working hours. Non-emergency calls should be made during breaks or lunch. 3. Building Security a. Report to the City Representative in writing any walls, rooms, carpeting, equipment and furniture damaged by vandalism, graffiti, stains, water leaks, etc. b. Secure and lock all doors before leaving unoccupied buildings. c. Turn off all lights not left on for security reasons as instructed. d. Activate intrusion alarm security systems after completing work and before leaving buildings. e. Deactivate security systems before entering buildings at the beginning of work as instructed and where applicable. f. Report in writing to the City Representative security system false alarms activated by Contractor’s employees or otherwise occurring during janitorial service when no City employee is present. g. Provide to the City Representative a list of the keys and codes issued to Contractor’s employees. This list will include employee names, addresses and telephone numbers that these codes and keys are issued to. Contractor will notify the City Representative of all and any keys or other pass code information lost by Contractor’s employees. h. Contractor shall not duplicate keys without first receiving written permission from the City Representative. i. Contractor is responsible for retrieving all City security information from those employees no longer employed by the Contractor, for whatever reason. j. Contractor will notify the City Representative within 24 hours in writing of any Contractor employee whose employment has been terminated that has or has had City security information or appurtenances. Page 574 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 k. Contractor is responsible for the cost of any re-keying, entry code, or security code changes needed due to non-retrieval of this security information, keys or appurtenances from their past employees. 4. City Holiday Schedule The City of Chula Vista’s public offices will be closed in observation of the following holidays. The Libraries and Recreation Center sites will not be cleaned on these dates: • New Year’s Day • Martin Luther King, Jr. Day • Cesar Chavez Day • Memorial Day • Independence Day • Labor Day • Veterans’ Day • Thanksgiving Day (and the day after) • Christmas Day Services will continue to be provided at the Police Department on City Holidays. 5. Tasks a. Contractor will separate all recyclable material from other refuse and deposit in appropriate receptacle at each facilities serviced location. b. Contractor will leave each facility visually clean having wiped, spot removed, dusted mopped, vacuumed, emptied or otherwise cleaned each area per this document to the standards defined within this document, industry standard and City expectation. c. The following is a guideline for cleaning these areas as defined in this document. The intent of this document is to find these areas visually clean, all hard surfaces sanitized, all fabrics unstained, vacuumed and ready for use upon entry every day. All areas should smell clean but should not have a bold cleanser smell upon entry. Police Department – Excluding Jail Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Sweep receiving area Weekly Offices, Conference rooms, Corridors and Stairs/Elevators Page 575 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items Weekly Arrange chairs as needed Daily Sanitize and polish water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Other Services Evening trash pick-up from Jail Daily High dust common areas and offices Monthly Clean lobby windows (inside and outside) Monthly Scrub restroom floors Monthly Buff hard floors Monthly High dust vents and light fixtures Quarterly Page 576 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual Police Department – Jail Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items weekly Arrange chairs as needed Daily Sanitize water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Page 577 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Other Services Cell and shower area sanitation with high pressure washer – rotating Weekly High dust common areas and offices Monthly Clean lobby windows (inside and outside) Monthly Scrub restroom floors Monthly Buff hard floors Monthly Routine cleaning of walk in fridge and oven in kitchen area Bi-monthly Deep freeze defrost and cleaning Quarterly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual Libraries – Civic Center Branch, South Chula Vista, and Otay Ranch Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Page 578 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items weekly Arrange chairs as needed Daily Sanitize water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Other Services High dust common areas and offices Monthly Clean lobby windows (inside and outside) Monthly Scrub restroom floors Monthly Buff hard floors Monthly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual Page 579 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Recreation Center – Heritage, Veterans, Norman Park, Loma Verde Description Task Frequency Exterior and Entry Areas Clean entry glass Daily Remove trash Daily Sweep entry walks Daily Sweep entry Daily Disinfect high touch surface Daily Offices, Conference rooms, Corridors and Stairs/Elevators Remove trash and recycle bins Daily Vacuum carpets Daily Detail vacuum carpets - Spot clean carpets Weekly Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces Daily Spot clean glass dividers Daily Dust up to 6 feet vertical surfaces Weekly Dust desk or table surfaces (papers and items shall not be moved) Weekly Polish wood surfaces that a free of paper and items weekly Arrange chairs as needed Daily Sanitize water fountains Daily Restrooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize urinals and toilets Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Pour water down floor drains Weekly Lunchrooms, kitchen areas, and break rooms Remove trash and recycle Daily Sweep and mop hard floors Daily Disinfect high touch surfaces Daily Spot clean vertical surfaces up to 6 feet Daily Sanitize tables and chairs and arrange chairs Daily Sanitize sinks and counters Daily Refill and clean dispensers Daily Sanitize appliances Daily Page 580 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Other Services High dust common areas and offices Monthly Clean lobby windows (inside and outside) Monthly Scrub restroom floors Monthly Buff hard floors Monthly High dust vents and light fixtures Quarterly Seal restroom floors Quarterly Dust blinds Semi Annual Vacuum upholstered furniture Semi Annual Clean interior common and partition glass Semi Annual 6. Products a. Contractor will maintain an adequate inventory of janitorial supplies, products and equipment sufficient to meet the agency’s needs. The City will provide paper products, the contractor will provide cleaning products and related janitorial equipment. b. Contractor will replenish on each service date all products used in that facility. At the end of each service, each location will have extra supplies of two cases of toilet tissue and paper hand towels, an ample supply of each additional paper product, two cans of each spray product applicable, two gallons of each floor cleaning chemical product used at that facility, two gallons of liquid hand cleaner, two gallons of window cleaner, two gallons of sanitizer, and all other cleaning appurtenances in good condition such as, but not limited to - broom, clean mop, bucket and wringer, dust pan, fox tail brush, toilet brush, and other cleaning items. c. Some sites have limited storage capability. It is the contractor’s responsibility to supply, provide and store products for the service of these areas in a manner that serves the City best at the discretion of the City Representative. d. With the above exception, all other products will be stored off site. No items other than those shown will be stored in the City facility. e. All products will meet or exceed the City’s specifications. f. All products proposed for use by the Contractor on any site covered by this contract will first be approved through the submittal process as defined within this document. The City will not pay any additional costs for Contractor requested substitutions when the City listed approved products are still available. The City reserves the right to approve or disapprove any product. g. All products will be removed from boxes and stowed neatly on shelves and racks for easy access and inventory. Page 581 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 h. Contractor will provide the City with Safety Data Sheet(s) (SDS) information on all product submittals. i. Contractor is responsible for providing SDS information to their employees. j. Previously used products list: DESCRIPTION SUPPLIER 1. Glass Cleaner Waxie 2. Stainless Steel Cleaner Waxie 3. Neutral Floor Cleaner Waxie 4. General Restroom Disinfectant Waxie 5. Urinal Deodorized Screens Waxie 6. General Multipurpose Cleaner Waxie 7. Furniture Polish Waxie 8. Industrial Degreaser Waxie 9. Floor Sealant/Wax and Floor Stripper Waxie 10. Bathroom Tile Cleaner Waxie 11. Toilet Bowl and Fixture Cleaner (Mild acid based) Waxie 12. Solsta Dilution System Waxie All Cleaning products (if available) will be green based and must be approved by the City of Chula vista before use at city facilities. 7. Equipment a. Contractor will supply and maintain all tools and equipment in good and proper working condition, such as clean mops, brooms, bucket and wringers, carts, dust pans, dusters, vacuum cleaners, janitorial vehicles, cleaning supplies and chemicals, and secure an adequate inventory of all janitorial supplies and products. b. All equipment provided by the Contractor will be of commercial grade. c. Contractor will supply each facility two mops, a “clean mop” for kitchens, lunchrooms, prep areas, etc. and another mop for all other areas and incidental cleanups. d. “Clean mops” will be marked so that employees of the City as well as Contractor’s employees can easily recognize these tools as clean. e. Contractor will replace all mops as needed to ensure adequate, sanitary cleaning. f. All equipment stored on site at a City facility will be stored neatly and orderly. All Janitors closets will be stowed in such a way that City employees can easily find what is needed, during their work shift, without moving other items - except for the janitorial cart. All mops, brooms, Page 582 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 dust pans, and other cleaning appurtenances will be either hung or shelved neatly when they are stored. g. Any storage shelf/ cabinet units needed for the storage of the supplies as described in this document at any facility listed is subject to the approval process in section 9 (submittals). Once approved, the shelf unit will be installed by the City. h. Any rack systems needed for storage of other janitorial equipment as described in this document at any facility listed is subject to the approval process in section 9 (submittals). i. Any chemical dispensing unit/equipment and appurtenances that the Contractor finds critical to their operation is subject to the approval process in section 9 (submittals). Purchase, assembly, and installation will be done, contracted, or coordinated by the Contractor at their expense and under the direction of City staff. This is not a reimbursable item. 8. Submittals a. All materials and consumable products are subject to prior approval by the City’s Representative. Contractor will provide submittals for the following items to the City’s Representative for approval. All materials and consumable products used at these project sites will be subject to prior approval through this submittal application process. No materials will be accepted for use on this project without prior approval in writing. All submittals will have the appropriate MSDS attached for City review. b. Any Contractor requested replacements/ substitutions for the items listed in “PRE- APPROVED PRODUCTS” are subject to this approval process. 9. Service Adjustments The City reserves the right to increase or decrease the services as needed. Services and fees for new facilities shall be added at the average rate per square foot for a comparable facility at the time of the addition. Such changes will be according to the terms and conditions of said bid specification and will be done through a duly authorized change notice to the master agreement for regular service and by City-approved proposal for event or special cleanings. 10. Site Inspection and Reporting a. Report immediately by telephone (during regular working hours (619) 397-6000, after hours issues call Chula Vista Police Department dispatch at (619) 691-5151) any issues that may require immediate action. For emergencies call 911. i. Incidents of injury, damage or potential hazards to the public, end users or employees. ii. Running water (roof leaks, faucet leaks, ceiling leaks) iii. Power outages or light bulb replacement iv. Sewer and drain backups or clogging and foul smells and odors v. Ceiling tile stains and deformation Page 583 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 b. Report immediately by e-mail issues such as, but not limited to: i. Public nuisances ii. Work performance delays iii. Repairs needed iv. Dripping water v. Non-emergency electrical issues such as, but not limited to, outlets without power or entire buildings without power. vi. Lost and found articles 1) Deliver any lost and found article from the Library to the Library Administrative Secretary that date. 2) Deliver any lost and found article from the Police Department to the Watch Commander 11. Payments a. Contractor will submit a monthly payment invoice listing each of the facilities serviced and each individual invoice amount. b. If the City determines that there are deficiencies in the performance of this contract, the Contractor will be notified both verbally and in writing each time service requirements are found to be unsatisfactory and corrective action is necessary. Should the Contractor fail to correct any deficiencies within 12 hours, the City may exercise the following measures: i. Deduct from the Contractor’s payment the amount necessary to correct the deficiency. ii. Withhold the entire or partial payment. iii. Utilize City forces or alternate source to correct the deficiency and deduct from the Contractor’s payment the total cost, including City overhead. c. Invoices will be submitted to the Building Services Supervisor City of Chula Vista Public Works 1800 Maxwell Road Chula Vista, CA 91911 12. Quality Assurance Contractor is responsible for training, supervising, equipping, checking work quality, ensuring adherence to schedule, and all other management issues involved with their employees. Quality control is the responsibility of the Contractor. 3. Term: In accordance with Section 1.10 of this Agreement, the term of this Agreement shall begin July 1, 2022 and end on June 30, 2024 for completion of all Required Services. 4. Compensation: Page 584 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 A. Form of Compensation ܈ Fixed Fee Paid in Monthly Increments. For the completion of each Deliverable of the Required Services, as identified in Section 2.B., above, City shall pay the fixed fee associated with each Deliverable, in the amounts set forth below. CONTRACTOR agrees to provide all labor necessary to perform custodial services for the following facilities in accordance with the provisions and specifications listed in this Agreement. All paper-based products and hand-soaps shall be purchased by the City. Base Line Cleaning Services Labor Pricing ACTIVITY PER HOUR COST Labor, Hourly Rate DURING Regular Work Hours (M-F 6:00 am to 5:00 pm) $30.00 Labor, Hourly Rate AFTER Regular Work Hours $34.50 Location Time of Service Staffing/ Hours Est. Square Footage FY 2022-23 FY23-24 Chula Vista Police Department (excluding Jail) 4:00 am to 12:30 pm Monday to Friday 8:00 am to 5:00 pm Monday to Friday 6:00 am to 2:30 pm Weekends and City Holidays 1 staff - 8 hours 1 staff – 8 hours each 1 staff – 8 hours each 132,374 square feet interior (gross) 150,314 square feet garage 8,517 exterior walkways $9,324.00 $9,790.20 Chula Vista Police Department – Jail 4:00 am to 12:30 pm Monday to Friday 1 staff - 8 hours 16,000 square feet $3,790.00 $3,979.50 Chula Vista Library – Civic Center Branch 8:00 am to 4:30 pm Monday to Friday 1 staff - 8 hours each 71,085 square feet $4,736.00 $4,972.80 Page 585 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 8:00 am to 12:30 pm Saturday and Sunday 1 staff – 4 hours each Chula Vista Library South Branch 8:00 am to 4:30 pm Monday to Friday 8:00 am to 12:30 pm Saturday and Sunday 1 staff - 8 hours each 1 staff – 4 hours each 38,614 square feet $4,736.00 $4,972.80 Chula Vista Library – Otay Ranch Branch 6:00 am to 8:00 am Monday to Friday 1 staff - 2 hours each 3,900 square feet $925.00 $971.25 Recreation Center – Veterans 10:00 am to 2:00 pm Sunday to Thursday 1 staff - 4 hours each 15,885 square feet $1,949.00 $2,046.45 Recreation Center – Heritage 8:00 am to 10:00 am Sunday to Thursday 1 staff - 2 hours each 6,000 square feet $950.00 $997.50 Recreation Center - Norman Park Senior Center 5:00 am to 1:30 pm Monday to Friday 1 staff - 8 hours each Main building 15,760 square feet Annex 6,336 square feet $3,825.03 $4,016.28 Recreation and Aquatic Center - Loma Verde 8:00 am to 4:30 pm Monday to Friday 8:00 am to 12:30 pm Saturday 1 staff - 8 hours each 1 staff – 4 hours each 23,325 square feet $5,055.00 $5,307.75 Page 586 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 Saturday Services at various Recreation Centers 5:00 am to 1:30 pm Saturday Only 1 staff - 8 hours each $1,479.00 $1,552.95 Monthly Total: $36,769.03 $38,607.48 Annual Total $441,228.36 $463,289.78 Note: Services for Libraries and Recreation Centers – Libraries and Recreation Centers are currently restricted due to COVID-19 protocols. Hours of operation may be increased as restrictions are modified. Services for Loma Verde Recreation and Aquatic Center is for the recreation portion only - services for aquatic center to be added. Work Schedule - The Contractor shall accomplish all janitorial services based on the schedule noted above. Contractor shall adhere to all scheduling as defined in this document unless a schedule change has been approved by the City in writing. B. Reimbursement of Costs ܈ Invoiced or agreed-upon amounts as follows: Monthly costs per Facility are included on the table above. In addition, the City may use the Contractor for the following Services at the rates noted below: Additional Window Cleaning Cost per Sq. Ft. $0.75 Additional Carpet Shampooing Cost per Sq. Ft. $0.12 Stripping and Waxing Service Cost per Sq. Ft. $0.25 Additional Cleanup Services (regular working hours) Cost per Hour $30.00 Additional Cleanup Services (call-backs for after-hours, weekends and holidays with one (1) hour response time) Cost per Hour $34.50 AND Notwithstanding the foregoing, the maximum amount to be paid to the Consultant for services performed through June 30, 2024 shall not exceed $1,500,000. If the City exercises its option to extend the Agreement, the amount to be paid to the Consultant for services provided during the term of that extension shall not exceed $750,000. If the City exercises all additional options to extend the Agreement, the total amount to be paid to the Consultant for services provided during the initial and optional extension periods shall not exceed $3,500,000. 5. Special Provisions: Page 587 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda City of Chula Vista Amendment to Agreement No.: 2023-026 Consultant Name: Nova Commercial Rev. 1/24/2023 ܈ Security for Performance: In the event that Exhibit A Section 4 indicates the need for Contractor/Service Provider to provide additional security for performance of its duties under this Agreement, Contractor/Service Provider shall provide such additional security prior to commencement of its Required Services in the form and on the terms prescribed on Exhibit A, or as otherwise prescribed by the City Attorney ܈ Options to Extend: Notwithstanding the completion date set forth in section 3.C., above, City has option to extend this Agreement for up to three additional years, in one-year increments. The Director of Finance/Treasurer shall be authorized to exercise the extensions on behalf of the City. If the City exercises an option to extend, each extension shall be on the same terms and conditions contained herein, provided that the amounts specified in Section 3., above, may be increased by up to the rate of inflation as reflected by the San Diego Consumer Price Index ("CPI") - for Urban Wage Earners and Clerical Works (CPI-W), up to a maximum increase of 5% for any (1) additional term for each extension. The City shall give written notice to Contractor/Service Provider of the City’s election to exercise the extension. Such notice shall be provided at least 30 days prior to the expiration of the term. Page 588 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ¬ @MHSNQH@KDQUHBDR§QHFHM@KNMSQ@BS %HIRUH •March 4, 2022 Issued RFP for janitorial services at various City Facilities •RFP was posted and made available on PlanetBids •RFP closed on March 25th ; City received six proposals •A review committee evaluated, scored, and ranked the responses based on experience, personnel, operations/qualifications and cost •Nova Commercial was ranked as the top vendor •July 12, 2022 Council awarded the contract for janitorial services to Nova Commercial •Key provisions of the contract included: •Services - provide janitorial services at designated City Facilities (including cleaning and disinfecting entry areas, offices, lunchrooms, restrooms, and break rooms •Facilities – Police, Libraries, Heritage Recreation Center, and Veterans Recreation Center •Term – initial term covered July 1, 2022 to June 30, 2023 with four additional one year periods with price increased based on CPI, not to exceed 5% •Total not to exceed value of the contract was $2.25 million including all extensions Page 589 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda @MHSNQH@KDQUHBDR§NMSQ@BSLDMCLDMS %HIRUH •Extend the initial term of the contract to end June 30, 2024 with three optional one-year extensions (total years remain at 5 years) •Add Janitorial services to various City Facilities: •Loma Recreation and Aquatic Center (Recreation side only, Aquatic Center to be added) •Norman Park Senior Center •Saturday services at various Recreation Centers •Increase the total contract to a maximum of $3.5 million for the five year term (including extensions) Page 590 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 591 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda P a g e | 1 v . 0 0 3 May 16, 2023 ITEM TITLE ȋȌǣ Report Number: ʹ͵ǦͲͳͳ͸ Location: ͸͹Ͳ Department: Environmental Notice: ͳͷ͵Ͳͳͳȋ Ȍǡͳͷ͵Ͳ͵͵ ȋȌǡͳͷ͵ͲͶͶȋ ȌǤȋȌǡʹͶǡ ͷͺǤ͵ͶȋȌȋʹȌȋ͵ȌƬȋͳͲȌ Ǥ Recommended Action ǣȋͳȌǡȋʹȌ ǲͳǳǡȋ͵Ȍ ͳǡȋͶȌ̈́ͻͲͲǡͲͲͲ Ǥ(4/5 Vote Required) SUMMARY ʹ͵ǡʹͲʹʹǤʹͲʹʹǦʹͲ͵ ǤǡǦ ǦǤǡ ȋǲͳǳȌ Ǥ ENVIRONMENTAL REVIEW ȋȌ ͳͷ͵Ͳͳͳȋ Ȍǡͳͷ͵Ͳ͵͵ȋ Page 592 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page |2 Ȍǡͳͷ͵ͲͶͶȋȌ ǡ ǡǡ Ǥ ǡ Ǥ ǡ ʹͶǡͷͺǤ͵ͶȋȌȋʹȌȋ͵ȌƬȋͳͲȌ Ǥ BOARD/COMMISSION/COMMITTEE RECOMMENDATION ʹ͹ǡʹͲʹ͵Ǥ DISCUSSION ParkClosureHistory ʹͲʹʹ Ǥ Ǥ ǡ ǡ Ǥ Ǧ Ǥ ͵ͳǡʹͲʹʹ ͻͲǦǡ ǯǤ ǡ Ǥ ǣȀȀǤȀͳǤ Exhibit1:HarborsideParkClosureandOutreachProcess Community Outreach CommunitySurvey#1 ʹͲʹʹǡ ǡ Ǧ Ǧ Ǥ ͷͲͲ ǡ Ǥ ͵ͲͲ ǡ ͳͺͶʹͲʹʹǤ Page 593 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda P a g e | 3 ǡ Ǥ ǡǡǡʹǤ Exhibit 2: Community Survey #1 Long-Term Preferred Uses ǡǦ ǡǤ Ǥ Ǥ Ǥ Community Survey #2 ǡ Ǥ ʹͲʹ͵ ǡͳǡ ǦǤ ͳͷǡ ʹͲʹ͵ǡ Ǥ ǣǡ ȋͶȀͳͷȌȋͶȀʹʹȌǡǡ ǡǤ ͻǡ͵ͲͲ͓ʹ͸ͳΨ ǲǳǲǳͳ ͵͹ǤǤ͹͵Ψǲǳǲǳ ͳͲǤǤ͹ǤǤǡ ͳͷǤ ȋǣȀȀǤȀ) ͳ͸Ǥ Page 594 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda P a g e | 4 Current Park Site Status ͵ͳǡʹͲʹʹǡ ǡǣ x Ǣ x Ǣ x Ǣ x ƬǤ ǡ Ǥǡ Ǥ ǡǤ Proposed Phase 1 Improvements ͳ͓ʹ ǡ͵Ǥ Exhibit 3: Community Survey #2 Proposed Phase 1 Improvements ǡ ǡͶǤǣȋͳȌǢȋʹȌ Ǣȋ͵ȌǢȋͶȌǢ ȋͷȌǢȋ͸ȌǦǢȋ͹Ȍ Page 595 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda P a g e | 5 ǢȋͺȌ Ǥ Exhibit 4: Staff Proposed Phase 1 Improvements ͳ̈́ͷͻͲǡͲͲͲǡ̈́͸ͲǡͲͲͲǡ ̈́ʹͷͲǡͲͲͲǡ̈́ͻͲͲǡͲͲͲǤ Ǥ Funding for Phase 1 Improvements ͳͲǡʹͲʹͳǡǤǤ ǡʹͲʹͳȋǲǳȌǡ̈́͵ͷͲ ǡǡǡǤ Ȅǡǡǡǡ ǦǤ ̈́ͷ͹Ǥͷǡ ʹͶǡʹͲʹͳʹͲʹʹǦʹ͵Ǥ Ǥ ̈́ͻͲͲǡͲͲͲ ͳ ̈́ͻͲͲǡͲͲͲ ǡͳǤ Page 596 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda P a g e | 6 Table 1: Eighth Amendment to the ARPA Spending Plan Long-Term Plans & Conclusion ʹ͵ Ǥ ǡǤ ǡ ͳǤ ͳ ȋ͸ȌȋͺȌǤ DECISION-MAKER CONFLICT ͳǡͲͲͲǤǡ Ǧ ʹǡͳͺ͹ͲʹǤʹȋȌȋ͹ȌȋͺȌǡȋǤ ǯ Țͺ͹ͳͲͲǡǤȌǤ ǡǡ ǦǤ Page 597 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda P a g e | 7 CURRENT-YEAR FISCAL IMPACT ̵ ͳ Ǥ ̈́ͻͲͲǡͲͲͲ ͲͲͳͻǤ ONGOING FISCAL IMPACT ̵ ͳ Ǥ ǯǤ ATTACHMENTS Ǥ Staff Contact: Stacey Kurz, Director of Housing & Homeless Services Page 598 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda RESOLUTION NO. __________ RESOLUTION OF THE CITY COUNCIL OF THE CITY OF CHULA VISTA (1) APPROVING AN EIGHTH AMENDMENT TO THE AMERICAN RESCUE PLAN ACT SPENDING PLAN, (2) APPROVING THE PHASE 1 IMPROVEMENTS TO HARBORSIDE PARK AT 670 OXFORD STREET, (3) AUTHORIZING THE CITY MANAGER OR DESIGNEE TO ENTER INTO ALL AGREEMENTS OR CONTRACTS NECESSARY TO IMPLEMENT PHASE 1, AND (4) REALLOCATING $900,000 IN FUNDS AND AMENDING THE AMERICAN RESCUE PLAN ACT BUDGET THEREFOR WHEREAS, on May 10, 2021, the U.S. Department of the Treasury announced the launch of the Coronavirus State and Local Fiscal Recovery Funds, established by the American Rescue Plan Act of 2021 (“ARPA”), to provide $350 billion in emergency funding for eligible state, local, territorial, and Tribal governments; and WHEREAS, ARPA was intended to provide support to local governments in responding to the impact of COVID-19 and in their efforts to contain COVID-19 in their communities, residents, and businesses; and WHEREAS, ARPA includes State and Local Fiscal Recovery Funds to support urgent COVID response efforts to decrease the spread of the virus, replace lost public sector revenue to strengthen support for vital public services, support immediate economic stabilization for households and businesses, and address systemic public health and economic challenges that have contributed to inequal impacts of the pandemic on certain populations; and WHEREAS, the Coronavirus State and Local Fiscal Recovery Funds provide substantial flexibility for each jurisdiction to meet local needs—including support for households, small businesses, impacted industries, essential workers, and the communities hardest-hit by the crisis; and WHEREAS, the City of Chula Vista received $57,535,250 in two tranches with $28,767,625 provided in May 2021 and the remaining $28,767,625 received twelve months later; and WHEREAS, on August 24, 2022 via Resolution No. 2022-203 and under Chula Vista Municipal Code (“CVMC”) Chapter 2.66, Park and Facility Rules, Harborside Park, at 670 Oxford Street, was temporarily closed in consideration of the risks to public health and safety because of illegal activity at the site; and WHEREAS, the closure of Harborside Park was necessitated by exacerbated problems around homelessness during the pandemic; and Page 599 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda WHEREAS, during the closure staff has been working with the community to consider long-term options for the park site and staff has provided the results of such efforts and opportunities identified by the community to City Council, including an initial “Phase 1” improvement plan; and WHEREAS, under the Phase 1 improvement plan, up to $900,000 would be utilized to make improvements including installation of permanent fencing around the park site, turf replacement and irrigation repairs, improvements to lighting and security cameras, repairs to restroom facilities, general clean-up of the site, resurfacing of the basketball courts, and purchase and installation of a park ranger station; and WHEREAS, City staff is recommending the reallocation of $900,000 in previously appropriated ARPA funds towards the Phase 1 Harborside Park improvements and amending the American Rescue Act Spending Plan, accordingly, by reallocating $900,000 from the Revenue Recovery Category to the Negative Economic Impacts Category. NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Chula Vista that it hereby amends The American Rescue Plan Act Spending Plan and reallocates funds within the American Rescue Plan Act 2021 Fund (Fund 268) and amends the Revenue Recovery category budget for project CRF0019 as follows: Revenue Recovery: University Innovation (Project CRF0019) ($900,000) Negative Economic Impacts: Harborside Park $900,000 BE IT FURTHER RESOLVED that City Council approves the proposed Phase 1 improvements to Harborside Park, as presented, and authorizes the City Manager or designee to negotiate and execute any required agreements necessary to implement the improvements, in a form approved by the City Attorney, with a total amount not to exceed $900,000. Presented by Approved as to form By: Stacey Kurz Jill D.S. Maland Director of Housing & Homeless Services Lounsbery Ferguson Altona & Peak Acting City Attorney Page 600 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Item 7.1 - Action Harborside Park Phase 1 Improvements Presented by: Stacey Kurz, Director of Housing & Homeless Services Page 601 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 6, Table 1: ARPA Eighth Amendment Page 602 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Harborside Park 670 Oxford StreetNTMSX QDMSVNNC Page 603 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Safety Forums • June 2 •July 14 Park Closure & Connect Event • August 31 Community Outreach 2022 •September 21 • October 25 • November 14 Community Surveys • October 2022 • May 2023 Park Closure History https://chulavistaca.gov/parkupdates Page 604 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #1 Page 605 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 Phased Improvements 1) Initial Reopening •Likelihood of Use •Hours •Amenities 2) Outdoor Amenities •Theme •Outdoor Exercise •Programming 3) Community Center •Indoor Space •Outdoor Space Page 606 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 - Respondents 91910 25% 91911 63% 91913 5% 91914 1% 91915 4% 91902 2% 350 Respondents 53 90 62 136 36 0 20 40 60 80 100 120 140 160 <6 6-12 13-19 20-64 >65 Age of Households (Persons reporting) 66% 4 or more in Household 70% First Time ParticipatingPage 607 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Proposed Phase 1 Improvements 1) Permanent fencing 2) Turf replacement & irrigation 3) Resurfacing basketball court 4)Lighting & Security camera 5) Restroom facility 6) General clean-up 7) Removal of the amphitheater & landscape 8) Ranger Station Page 608 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 – Phase 1 Very Likely 28% Somewhat Likely 48% Not Likely 24% Weekdays 3-7pm Very Likely 33% Somewhat Likely 46% Not Likely 21% Weekends 10am-7pm 76%79%Page 609 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 – Phase 1 113 142 82 157 0 20 40 60 80 100 120 140 160 180 Basketball Court Grass Area Skate Park Walking Trail Very Likely or Somewhat Likely to Use Existing Park Amenities Page 610 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda ARPA Eighth Amendment Page 611 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Recommendation 1) Approve eighth amendment to the American Rescue Plan Act Spending Plan; 2) Approve “Phase 1” improvements to Harborside Park; 3) Authorize the City Manager or designee to enter into all agreements or contracts; and 4) Reallocate $900,000 in funds and amending budget. Provide direction on Phase 2 and 3 concepts.Page 612 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Phase 2 ConceptsPage 613 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 – Phase 2 59 100 18 18 0 20 40 60 80 100 120 Arts Fitness Music Nutrition First Choice for Park Theme Page 614 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 – Phase 2 34% 5%61% Type of Trees 27% Fitness Court 52% Fitness Equipment 21% Neither Type of Outdoor Fitness Page 615 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Phase 3 ConceptsPage 616 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 – Phase 3 Computer Room 21% Game Room 9% Pre & Post School 20% Reading Room 4% Scouts/Children 19% Tutoring 27% Programming 96 71 28 0 20 40 60 80 100 120 Very Likely Somewhat Likely Not Likely Gathering Spaces 85% Page 617 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Community Survey #2 – Phase 3 6 35 7 117 15 Bocce Community Garden Cornhole Fitness Patio Ping Pong Outdoor Amenities 40 42 60 32 Crafts Room Cooking Class Cultural Arts Gallery Soundproof Music Space Indoor Amenities So Page 618 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Recommendation 1) Approve eighth amendment to the American Rescue Plan Act Spending Plan; 2) Approve “Phase 1” improvements to Harborside Park; 3) Authorize the City Manager or designee to enter into all agreements or contracts; and 4) Reallocate $900,000 in funds and amending budget. Provide direction on Phase 2 and 3 concepts.Page 619 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 620 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 621 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 622 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 623 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 624 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 625 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 626 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 627 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 628 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 629 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 630 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 631 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 632 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 633 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 634 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 635 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 636 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 637 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 638 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 639 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 640 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 641 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 642 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 643 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 644 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 645 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda Page 646 of 646 City of Chula Vista City Council May 16, 2023 Post Agenda